Comparing Ga0059261_0941 FitnessBrowser__Korea:Ga0059261_0941 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2h12B Structure of acetobacter aceti citrate synthase complexed with oxaloacetate and carboxymethyldethia coenzyme a (cmx) (see paper)
65% identity, 100% coverage: 2:424/424 of query aligns to 1:426/426 of 2h12B
4jagA Structural determination of the a50t:s279g:s280k:v281k:k282e:h283n variant of citrate synthase from e. Coli complexed with oxaloacetate (see paper)
66% identity, 97% coverage: 15:424/424 of query aligns to 19:426/426 of 4jagA
4jaeA Structural determination of the a50t:s279g:s280k:v281k:k282e:h283n variant of citrate synthase from e. Coli complexed with s- carboxymethyl-coa (see paper)
66% identity, 97% coverage: 15:424/424 of query aligns to 19:426/426 of 4jaeA
P0ABH7 Citrate synthase; EC 2.3.3.16 from Escherichia coli (strain K12) (see 2 papers)
66% identity, 97% coverage: 15:424/424 of query aligns to 20:427/427 of P0ABH7
1nxgA The f383a variant of type ii citrate synthase complexed with nadh (see paper)
66% identity, 97% coverage: 15:424/424 of query aligns to 19:426/426 of 1nxgA
1owbA Three dimensional structure analysis of the variant r109l nadh complex of type ii citrate synthase from e. Coli (see paper)
66% identity, 97% coverage: 15:424/424 of query aligns to 19:426/426 of 1owbA
P9WPD5 Citrate synthase 1; EC 2.3.3.16 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
56% identity, 97% coverage: 12:424/424 of query aligns to 18:431/431 of P9WPD5
3msuB Crystal structure of citrate synthase from francisella tularensis
53% identity, 98% coverage: 4:418/424 of query aligns to 12:426/426 of 3msuB
3msuA Crystal structure of citrate synthase from francisella tularensis
51% identity, 98% coverage: 4:418/424 of query aligns to 12:415/415 of 3msuA
4tvmA Structure of citrate synthase from mycobacterium tuberculosis (see paper)
51% identity, 97% coverage: 12:421/424 of query aligns to 12:380/380 of 4tvmA
6abwA Crystal structure of citrate synthase (msed_0281) from metallosphaera sedula in complex with acetyl-coa (see paper)
38% identity, 88% coverage: 51:424/424 of query aligns to 8:369/369 of 6abwA
8bp7E Citrate-bound hexamer of synechococcus elongatus citrate synthase (see paper)
37% identity, 91% coverage: 39:424/424 of query aligns to 5:377/379 of 8bp7E
6abxA Crystal structure of citrate synthase (msed_1522) from metallosphaera sedula in complex with citrate (see paper)
36% identity, 90% coverage: 42:424/424 of query aligns to 6:370/370 of 6abxA
6abyA Crystal structure of citrate synthase (msed_1522) from metallosphaera sedula in complex with oxaloacetate (see paper)
36% identity, 90% coverage: 42:424/424 of query aligns to 6:370/372 of 6abyA
1aj8A Citrate synthase from pyrococcus furiosus (see paper)
36% identity, 88% coverage: 50:424/424 of query aligns to 12:370/371 of 1aj8A
1iomA Crystal structure of citrate synthase from thermus thermophilus hb8 (see paper)
38% identity, 90% coverage: 42:424/424 of query aligns to 4:374/374 of 1iomA
1ixeA Crystal structure of citrate synthase from thermus thermophilus hb8 (see paper)
38% identity, 90% coverage: 42:424/424 of query aligns to 4:371/371 of 1ixeA
P39120 Citrate synthase 2; Citrate synthase II; EC 2.3.3.16 from Bacillus subtilis (strain 168) (see paper)
33% identity, 90% coverage: 42:424/424 of query aligns to 6:371/372 of P39120
6s87D Crystal structure of 2-methylcitrate synthase (prpc) from pseudomonas aeruginosa in complex with oxaloacetate.
33% identity, 90% coverage: 42:424/424 of query aligns to 1:365/365 of 6s87D
O34002 2-methylcitrate synthase; 2-MCS; MCS; Citrate synthase; EC 2.3.3.5; EC 2.3.3.16 from Antarctic bacterium DS2-3R (see 2 papers)
34% identity, 89% coverage: 38:416/424 of query aligns to 5:376/379 of O34002
Sites not aligning to the query:
>Ga0059261_0941 FitnessBrowser__Korea:Ga0059261_0941
MTDSTLNIAGKDYPVRQGSVGPEVVDIRKFYAQTGQFTYDPGFTSTASCESGLTYIDGDE
GTLLHRGYPIGQLAEHSSFMEVAYLLLNGELPSKDELGTFSNTITRHTMVHEQLATFYRG
FRRDAHPMAVMCGVVGALSAFYHDSTDISDPYQRMVASHRLIAKMPTIAAMAYKYTVGQP
FLYPDNNLSYTGNFLRMTFGVPAEEYVVNPVVERALDRIFILHADHEQNASTSTVRLAGS
SGANPFACIAAGIACLWGPAHGGANEAALNMLREIGRPERIPEYIARAKDKNDPFRLMGF
GHRVYKNYDPRATVMQKTVREVLSALNVSDPLFDVALQLEEMALKDEYFVEKKLFPNVDF
YSGVILSAIGFPTTMFTVLFALARTVGWVAQWNEMISDPDQKIGRPRQLYTGPTERDYVP
LDKR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory