Comparing Ga0059261_0987 FitnessBrowser__Korea:Ga0059261_0987 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
P36035 Carboxylic acid transporter protein homolog from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
27% identity, 30% coverage: 77:234/533 of query aligns to 188:331/616 of P36035
Sites not aligning to the query:
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
25% identity, 42% coverage: 31:254/533 of query aligns to 52:247/444 of Q8NLB7
Sites not aligning to the query:
Q9Y7Q9 Probable metabolite transporter C2H8.02 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
27% identity, 29% coverage: 79:233/533 of query aligns to 98:262/583 of Q9Y7Q9
Sites not aligning to the query:
Q9R0W2 Solute carrier family 22 member 2; Organic cation transporter 2; rOCT2 from Rattus norvegicus (Rat) (see paper)
25% identity, 33% coverage: 79:252/533 of query aligns to 162:321/555 of Q9R0W2
Sites not aligning to the query:
8fvzA Pipt y150a
26% identity, 34% coverage: 21:200/533 of query aligns to 4:184/433 of 8fvzA
Sites not aligning to the query:
>Ga0059261_0987 FitnessBrowser__Korea:Ga0059261_0987
MATTVEDIRPEHEPSKSEMRQVVTASSLGTVFEWYDFFIYGTLAASGVIGRTFFATGNPV
LETLYAWAGFAVGFGFRPLGAVLFGYLGDKLGRKYTFLVTITLMGVATAGVGFVPSYASI
GAAAPAIVIGLRILQGLALGGEYGGAAIYVSEHSPTGQAGYHTSFIQASVSAGFILSLAV
VLITRFTMPQASFDDWGWRLPFIFSIALLAISLWMRVKLSESPVFKAMKEAGEVARNPLK
ESFTYPGNLRRLFVALFGIAAGLTVIWYTATFSVLSFLQGTMRVEPVAAQLLAAGGAAAG
LFWFILFGKLSDRIGRKKPIVIGYGFTLLLLFPIFWAMGHAANPALSDAARNAPVIVSGP
QCAYDPFAGKQADTCGQLLDYLSKKGVPYTKEVTPSAAVSVNGVPVISTETADIDKALTE
AGYNLDRVVPSTGNIVLILIAIVALAALSGATYGPVAALLTELFPPRIRYSSMSIPYHIG
TGYFGGFLPLISQYMVAKSGNAYSGLWYTWIVVAMALLVTLFFLREDDLYKEG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory