SitesBLAST
Comparing Ga0059261_1006 Ga0059261_1006 NAD-dependent aldehyde dehydrogenases to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4itbA Structure of bacterial enzyme in complex with cofactor and substrate (see paper)
48% identity, 99% coverage: 4:451/453 of query aligns to 4:452/453 of 4itbA
- active site: N130 (= N130), K153 (= K153), E227 (= E227), C261 (= C261), E358 (= E357), E435 (= E434)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: V126 (= V126), M127 (= M127), P128 (= P128), W129 (= W129), N130 (= N130), K153 (= K153), A155 (= A155), S156 (= S156), A186 (≠ S186), V189 (= V189), G205 (= G205), S206 (= S206), A209 (= A209), S212 (≠ K212), L228 (= L228), C261 (= C261), E358 (= E357), F360 (= F359)
- binding 4-oxobutanoic acid: E227 (= E227), C261 (= C261), S418 (= S417)
3vz3A Structural insights into substrate and cofactor selection by sp2771 (see paper)
47% identity, 99% coverage: 4:451/453 of query aligns to 4:452/453 of 3vz3A
- active site: N130 (= N130), K153 (= K153), E227 (= E227), A261 (≠ C261), E358 (= E357), E435 (= E434)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V126 (= V126), M127 (= M127), W129 (= W129), N130 (= N130), Q135 (= Q135), R138 (= R138), K153 (= K153), A155 (= A155), S156 (= S156), A186 (≠ S186), V189 (= V189), T204 (= T204), G205 (= G205), S206 (= S206), A209 (= A209), E227 (= E227), L228 (= L228), G229 (= G229), A261 (≠ C261), F360 (= F359)
- binding 4-oxobutanoic acid: F131 (= F131), W134 (= W134), S260 (= S260), A261 (≠ C261), I262 (= I262), S418 (= S417)
3efvA Crystal structure of a putative succinate-semialdehyde dehydrogenase from salmonella typhimurium lt2 with bound NAD (see paper)
45% identity, 98% coverage: 4:449/453 of query aligns to 8:454/459 of 3efvA
- active site: N134 (= N130), E231 (= E227), C265 (= C261), E439 (= E434)
- binding nicotinamide-adenine-dinucleotide: I130 (≠ V126), M131 (= M127), P132 (= P128), W133 (= W129), N134 (= N130), Q139 (= Q135), R142 (= R138), K157 (= K153), A159 (= A155), N190 (≠ S186), V193 (= V189), T208 (= T204), G209 (= G205), S210 (= S206), A213 (= A209), E231 (= E227), L232 (= L228), G233 (= G229), C265 (= C261), E362 (= E357), F364 (= F359), F428 (= F423)
4ywuA Structural insight into the substrate inhibition mechanism of NADP+- dependent succinic semialdehyde dehydrogenase from streptococcus pyogenes (see paper)
39% identity, 100% coverage: 2:453/453 of query aligns to 2:455/455 of 4ywuA
- active site: N131 (= N130), K154 (= K153), E228 (= E227), C262 (= C261), E359 (= E357), E436 (= E434)
- binding 4-oxobutanoic acid: N131 (= N130), Q136 (= Q135), R139 (= R138), E228 (= E227), V261 (≠ S260), C262 (= C261), F425 (= F423)
4ohtA Crystal structure of succinic semialdehyde dehydrogenase from streptococcus pyogenes in complex with NADP+ as the cofactor (see paper)
39% identity, 100% coverage: 2:453/453 of query aligns to 2:455/455 of 4ohtA
- active site: N131 (= N130), K154 (= K153), E228 (= E227), C262 (= C261), E359 (= E357), E436 (= E434)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V127 (= V126), E128 (≠ M127), P129 (= P128), W130 (= W129), K154 (= K153), H155 (= H154), A156 (= A155), S157 (= S156), Y187 (≠ S186), S207 (= S206), I214 (≠ V213)
3jz4A Crystal structure of e. Coli NADP dependent enzyme (see paper)
34% identity, 98% coverage: 6:451/453 of query aligns to 31:479/481 of 3jz4A
- active site: N156 (= N130), K179 (= K153), E254 (= E227), C288 (= C261), E385 (= E357), E462 (= E434)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: P154 (= P128), W155 (= W129), K179 (= K153), A181 (= A155), S182 (= S156), A212 (≠ S186), G216 (vs. gap), G232 (= G205), S233 (= S206), I236 (≠ A209), C288 (= C261), K338 (≠ T311), E385 (= E357), F387 (= F359)
P25526 Succinate-semialdehyde dehydrogenase [NADP(+)] GabD; SSDH; Glutarate-semialdehyde dehydrogenase; EC 1.2.1.79; EC 1.2.1.- from Escherichia coli (strain K12) (see paper)
34% identity, 98% coverage: 6:451/453 of query aligns to 32:480/482 of P25526
4o6rA Crystal structure of a putative aldehyde dehydrogenase from burkholderia cenocepacia
33% identity, 98% coverage: 5:449/453 of query aligns to 24:475/489 of 4o6rA
- active site: N150 (= N130), K173 (= K153), E248 (= E227), C282 (= C261), E383 (= E357), E460 (= E434)
- binding adenosine monophosphate: I146 (≠ V126), V147 (≠ M127), K173 (= K153), G206 (≠ S186), G210 (≠ S190), Q211 (≠ R191), F224 (≠ L203), G226 (= G205), S227 (= S206), T230 (≠ A209), R233 (≠ K212)
P17202 Aminoaldehyde dehydrogenase BADH; 4-trimethylammoniobutyraldehyde dehydrogenase BADH; Aminobutyraldehyde dehydrogenase BADH; Betaine aldehyde dehydrogenase; SoBADH; EC 1.2.1.-; EC 1.2.1.47; EC 1.2.1.19; EC 1.2.1.8 from Spinacia oleracea (Spinach) (see 3 papers)
32% identity, 98% coverage: 5:449/453 of query aligns to 28:482/497 of P17202
- I28 (= I5) binding
- D96 (≠ E71) binding
- SPW 156:158 (≠ MPW 127:129) binding
- Y160 (≠ F131) mutation to A: Decreases binding affinity for betaine aldehyde; increases binding affinity for 4-(trimethylamino)butanal.
- W167 (≠ R138) mutation to A: Decreases binding affinity for betaine aldehyde; increases binding affinity for 4-aminobutanal.
- KPSE 182:185 (≠ KHAS 153:156) binding
- L186 (= L157) binding
- SSAT 236:239 (≠ SEGA 206:209) binding
- V251 (≠ L221) binding in other chain
- L258 (= L228) binding
- W285 (≠ Q255) mutation to A: Decreases binding affinity for betaine aldehyde.
- E390 (= E357) binding
- A441 (≠ M408) mutation to I: Decreases binding affinity for betaine aldehyde; increases binding affinity for 4-aminobutanal.
- C450 (≠ S417) mutation to S: Loss of partial inactivation by betaine aldehyde in the absence of NAD(+).
- W456 (≠ F423) binding ; mutation to A: Decreases binding affinity for betaine aldehyde.
- K460 (= K427) binding
7a6qB Crystal structure of human aldehyde dehydrogenase 1a3 in complex with selective nr6 inhibitor compound (see paper)
34% identity, 99% coverage: 2:451/453 of query aligns to 31:487/489 of 7a6qB
- active site: N163 (= N130), E262 (= E227), C296 (= C261), E470 (= E434)
- binding nicotinamide-adenine-dinucleotide: I159 (≠ V126), W162 (= W129), K186 (= K153), E189 (≠ S156), G219 (≠ S186), G223 (vs. gap), S240 (= S206), V243 (≠ A209), K342 (≠ E307)
- binding (3-oxidanylidene-3-sodiooxy-propanoyl)oxysodium: A32 (≠ T3), T33 (≠ S4), C34 (≠ I5), P36 (= P7), D103 (≠ E71), E189 (≠ S156), Q190 (≠ L157), F218 (≠ K185), I339 (≠ S304), D340 (≠ S305)
- binding 3-(2-phenylimidazo[1,2-a]pyridin-6-yl)benzenecarbonitrile: G118 (≠ K85), D141 (≠ E105), N143 (≠ K107), N451 (≠ L415), L453 (≠ S417), A455 (≠ P419)
7a6qA Crystal structure of human aldehyde dehydrogenase 1a3 in complex with selective nr6 inhibitor compound (see paper)
34% identity, 99% coverage: 2:451/453 of query aligns to 31:487/489 of 7a6qA
- active site: N163 (= N130), E262 (= E227), C296 (= C261), E470 (= E434)
- binding nicotinamide-adenine-dinucleotide: I159 (≠ V126), T160 (≠ M127), W162 (= W129), K186 (= K153), A188 (= A155), E189 (≠ S156), G219 (≠ S186), G223 (vs. gap), S240 (= S206), V243 (≠ A209), K342 (≠ E307), K346 (≠ T311)
- binding 3-(2-phenylimidazo[1,2-a]pyridin-6-yl)benzenecarbonitrile: G118 (≠ K85), D141 (≠ E105), N143 (≠ K107), N451 (≠ L415), L453 (≠ S417), Y454 (≠ T418)
5fhzA Human aldehyde dehydrogenase 1a3 complexed with NAD(+) and retinoic acid (see paper)
34% identity, 99% coverage: 2:451/453 of query aligns to 31:487/489 of 5fhzA
- active site: N163 (= N130), K186 (= K153), E262 (= E227), C296 (= C261), E393 (= E357), E470 (= E434)
- binding nicotinamide-adenine-dinucleotide: I159 (≠ V126), T160 (≠ M127), W162 (= W129), K186 (= K153), E189 (≠ S156), G219 (≠ S186), G223 (vs. gap), F237 (≠ L203), G239 (= G205), S240 (= S206), T241 (≠ E207), V243 (≠ A209), G264 (= G229), Q343 (= Q308), E393 (= E357)
- binding retinoic acid: G118 (≠ K85), R121 (≠ A88), F164 (= F131), M168 (≠ Q135), W171 (≠ R138), C295 (≠ S260), C296 (= C261), L453 (≠ S417)
7qk9A Crystal structure of the aldh1a3-atp complex (see paper)
34% identity, 99% coverage: 2:451/453 of query aligns to 30:486/489 of 7qk9A
- binding adenosine-5'-triphosphate: I158 (≠ V126), T159 (≠ M127), P160 (= P128), W161 (= W129), K185 (= K153), E188 (≠ S156), G218 (≠ S186), G222 (vs. gap), F236 (≠ L203), S239 (= S206), V242 (≠ A209)
P47895 Retinaldehyde dehydrogenase 3; RALDH-3; RalDH3; Aldehyde dehydrogenase 6; Aldehyde dehydrogenase family 1 member A3; ALDH1A3; EC 1.2.1.36 from Homo sapiens (Human) (see 2 papers)
34% identity, 99% coverage: 2:451/453 of query aligns to 49:505/512 of P47895
- R89 (= R39) to C: in MCOP8; does not affect ALDH1A3 expression; results in strongly reduced protein levels; dbSNP:rs397514652
- K204 (= K153) binding
- E207 (≠ S156) binding
- GSTEVG 257:262 (≠ GSEGAG 205:210) binding
- Q361 (= Q308) binding
- E411 (= E357) binding
- A493 (≠ G439) to P: in MCOP8; does not affect ALDH1A3 expression; results in strongly reduced protein levels; dbSNP:rs397514653
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
4go4A Crystal structure of pnpe in complex with nicotinamide adenine dinucleotide
32% identity, 98% coverage: 5:449/453 of query aligns to 23:473/487 of 4go4A
- active site: N149 (= N130), K172 (= K153), E247 (= E227), C281 (= C261), E381 (= E357), E458 (= E434)
- binding nicotinamide-adenine-dinucleotide: I145 (≠ V126), V146 (≠ M127), W148 (= W129), N149 (= N130), F154 (≠ Q135), K172 (= K153), G205 (≠ S186), G209 (≠ S190), Q210 (≠ R191), F223 (≠ L203), T224 (= T204), G225 (= G205), S226 (= S206), T229 (≠ A209), E247 (= E227), G249 (= G229), C281 (= C261), E381 (= E357), F383 (= F359)
6j76A Structure of 3,6-anhydro-l-galactose dehydrogenase in complex with nap (see paper)
33% identity, 99% coverage: 5:451/453 of query aligns to 22:475/477 of 6j76A
- active site: N148 (= N130), E246 (= E227), C280 (= C261), E458 (= E434)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: I144 (≠ V126), T145 (≠ M127), A146 (≠ P128), W147 (= W129), N148 (= N130), K171 (= K153), T173 (≠ A155), S174 (= S156), G204 (≠ D187), G208 (vs. gap), T223 (= T204), G224 (= G205), S225 (= S206), A228 (= A209), S231 (≠ K212), I232 (≠ V213), E246 (= E227), L247 (= L228), C280 (= C261), E381 (= E357), F383 (= F359), H447 (≠ F423)
1o9jA The x-ray crystal structure of eta-crystallin (see paper)
32% identity, 99% coverage: 2:451/453 of query aligns to 31:487/494 of 1o9jA
- active site: N163 (= N130), K186 (= K153), E262 (= E227), C296 (= C261), E393 (= E357), E470 (= E434)
- binding nicotinamide-adenine-dinucleotide: I159 (≠ V126), F160 (≠ M127), P161 (= P128), W162 (= W129), N163 (= N130), K186 (= K153), E189 (≠ S156), G219 (≠ S186), G223 (vs. gap), F237 (≠ L203), T238 (= T204), G239 (= G205), S240 (= S206), V243 (≠ A209), E262 (= E227), L263 (= L228), C296 (= C261), E393 (= E357), F395 (= F359), L421 (= L385)
Q28399 Aldehyde dehydrogenase, cytosolic 1; ALDH class 1; ETA-crystallin; EC 1.2.1.3 from Elephantulus edwardii (Cape long-eared elephant shrew) (see paper)
32% identity, 99% coverage: 2:451/453 of query aligns to 38:494/501 of Q28399
4v37A Crystal structure of betaine aldehyde dehydrogenase from spinach showing a thiohemiacetal with 3-aminopropionaldehyde
32% identity, 98% coverage: 5:449/453 of query aligns to 26:480/495 of 4v37A
- active site: N157 (= N130), K180 (= K153), E255 (= E227), A289 (≠ C261), E388 (= E357), E465 (= E434)
- binding 3-aminopropan-1-ol: C448 (≠ S417), W454 (≠ F423)
- binding nicotinamide-adenine-dinucleotide: I153 (≠ V126), S154 (≠ M127), P155 (= P128), W156 (= W129), N157 (= N130), M162 (≠ Q135), K180 (= K153), S182 (≠ A155), E183 (≠ S156), G213 (≠ K185), G217 (≠ V189), A218 (≠ S190), T232 (= T204), G233 (= G205), S234 (= S206), T237 (≠ A209), E255 (= E227), L256 (= L228), A289 (≠ C261), E388 (= E357), F390 (= F359)
O94788 Retinal dehydrogenase 2; RALDH 2; RalDH2; Aldehyde dehydrogenase family 1 member A2; ALDH1A2; Retinaldehyde-specific dehydrogenase type 2; RALDH(II); EC 1.2.1.36 from Homo sapiens (Human) (see 6 papers)
33% identity, 100% coverage: 1:451/453 of query aligns to 54:511/518 of O94788
- A110 (= A54) to V: in dbSNP:rs35365164
- Q182 (≠ A125) to K: in DIH4; decreased retinoic acid biosynthetic process
- IPW 184:186 (≠ MPW 127:129) binding
- KPAE 210:213 (≠ KHAS 153:156) binding
- STE 264:266 (≠ SEG 206:208) binding
- C320 (= C261) active site, Nucleophile
- R347 (≠ V288) to H: in DIH4; decreased expression; dbSNP:rs141245344
- V348 (≠ K289) to I: in dbSNP:rs4646626
- KQYNK 366:370 (≠ EQRDT 307:311) binding
- A383 (= A324) to T: in DIH4; uncertain significance; dbSNP:rs749124508
- E417 (= E357) binding
- E436 (≠ A376) to K: in dbSNP:rs34744827
- S461 (≠ V401) to Y: in DIH4; decreased retinoic acid biosynthetic process
Sites not aligning to the query:
- 50 E → G: in dbSNP:rs34266719
Query Sequence
>Ga0059261_1006 Ga0059261_1006 NAD-dependent aldehyde dehydrogenases
MFTSINPATGEAGATFAALDDDAIEAALTRAEAAFRSWRASDIAQRTALLTAIADRFEAN
KRHLAETATKEMGKTLASAIAEVEKCIAGFRHYADKGPGYLAPIETKTASGRAVGHWLPL
GPILAVMPWNFPYWQVVRWLAPTILAGNVGLLKHASLTQGCAALIQQMVSAAGAPDGLFQ
NLPIKSDKVSRIIADTRVAAVTLTGSEGAGAKVAEAAGRALKKVVLELGGSDPFIVMPSA
DLDKAVATAVKARVQNAGQSCICAKRMIVHADVYDAFLDKFTAAMLAVKIGDPMEDGVEM
GPLSSVEQRDTVLEQVERAVADGATLAGGAKIERDGAWMEAGVLTHVHPDADFAQEEIFG
PVAMVFRADDIDAAIALANDVPFGLGSSVWTSDQAEIDRFVRDIESGMTAVNQLLASTPE
APFGGVKLSGHGRELGPWGLHEFMNLKAVMLAD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory