Comparing Ga0059261_1051 FitnessBrowser__Korea:Ga0059261_1051 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
6j2lA Crystal structure of bi-functional enzyme (see paper)
55% identity, 62% coverage: 5:70/107 of query aligns to 113:178/200 of 6j2lA
Sites not aligning to the query:
6j2lB Crystal structure of bi-functional enzyme (see paper)
45% identity, 62% coverage: 5:70/107 of query aligns to 106:163/185 of 6j2lB
Sites not aligning to the query:
>Ga0059261_1051 FitnessBrowser__Korea:Ga0059261_1051
MAADILDTLEAVIRERRTGDPATSYVAKLTAKGRAKIAQKLGEEAVEAAIAAVQDDRDGL
TGEAADLIFHLLVLLADTGLSLDDVRAELARREGISGIDEKASRHAD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory