SitesBLAST
Comparing Ga0059261_1055 FitnessBrowser__Korea:Ga0059261_1055 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3uboA The crystal structure of adenosine kinase from sinorhizobium meliloti
51% identity, 96% coverage: 6:323/332 of query aligns to 3:319/338 of 3uboA
- active site: R124 (= R128), G274 (= G278), A275 (= A279), G276 (= G280), D277 (= D281)
- binding adenosine: N10 (= N13), I12 (= I15), D14 (= D17), M34 (= M37), G57 (= G61), G58 (= G62), S59 (= S63), N62 (= N66), M126 (= M130), T128 (= T132), E155 (= E159), Y157 (= Y161), G274 (= G278), D277 (= D281), P313 (≠ A317)
- binding adenosine-5'-diphosphate: N214 (= N218), T244 (= T248), S246 (= S250), E247 (= E251), G249 (= G253), L266 (≠ I270), A275 (= A279), G276 (= G280), N301 (≠ A305), A304 (= A308), I308 (= I312)
4k8pA Crystal structure of probable sugar kinase protein from rhizobium etli cfn 42 complexed with 2-ethylbenzyl alcohol
47% identity, 97% coverage: 7:327/332 of query aligns to 7:326/332 of 4k8pA
- active site: R127 (= R128), G277 (= G278), A278 (= A279), G279 (= G280), D280 (= D281)
- binding (2-ethylphenyl)methanol: A45 (= A46), Y49 (= Y50), R116 (= R117)
- binding adenosine: N13 (= N13), I15 (= I15), D17 (= D17), M37 (= M37), G60 (= G61), G61 (= G62), S62 (= S63), N65 (= N66), M129 (= M130), T131 (= T132), E158 (= E159), Y160 (= Y161), T276 (= T277), D280 (= D281), P316 (≠ A317)
4lbxA Crystal structure of probable sugar kinase protein from rhizobium etli cfn 42 complexed with cytidine
47% identity, 97% coverage: 7:327/332 of query aligns to 6:325/331 of 4lbxA
- active site: R126 (= R128), G276 (= G278), A277 (= A279), G278 (= G280), D279 (= D281)
- binding adenosine: N12 (= N13), I14 (= I15), D16 (= D17), M36 (= M37), G59 (= G61), G60 (= G62), S61 (= S63), N64 (= N66), M128 (= M130), T130 (= T132), E157 (= E159), Y159 (= Y161), T275 (= T277), D279 (= D281), P315 (≠ A317)
- binding 4-amino-1-beta-d-ribofuranosyl-2(1h)-pyrimidinone: T246 (= T248), S248 (= S250), G251 (= G253), C303 (≠ A305), A306 (= A308), I310 (= I312)
4k8kA Crystal structure of probable sugar kinase protein from rhizobium etli cfn 42 complexed with 1-(4-methoxyphenyl)-1-cyclopropane and 2- aminoperimidine
47% identity, 97% coverage: 7:327/332 of query aligns to 6:325/331 of 4k8kA
- active site: R126 (= R128), G276 (= G278), A277 (= A279), G278 (= G280), D279 (= D281)
- binding 1-(4-methoxyphenyl)cyclopropanecarboxylic acid: A41 (= A43), A44 (= A46), E45 (≠ D47), Y48 (= Y50), P112 (≠ S114), R115 (= R117), M117 (≠ L119), Y131 (≠ F133)
- binding 1H-perimidin-2-amine: A84 (≠ D86), D85 (= D87), D89 (≠ A91)
- binding adenosine: N12 (= N13), I14 (= I15), D16 (= D17), M36 (= M37), G59 (= G61), G60 (= G62), S61 (= S63), N64 (= N66), M128 (= M130), T130 (= T132), E157 (= E159), Y159 (= Y161), T275 (= T277), D279 (= D281), P315 (≠ A317)
4lc4A Crystal structure of probable sugar kinase protein from rhizobium etli cfn 42 complexed with guanosine
47% identity, 97% coverage: 7:327/332 of query aligns to 5:324/330 of 4lc4A
- active site: R125 (= R128), G275 (= G278), A276 (= A279), G277 (= G280), D278 (= D281)
- binding adenosine: N11 (= N13), I13 (= I15), D15 (= D17), M35 (= M37), G58 (= G61), G59 (= G62), S60 (= S63), N63 (= N66), M127 (= M130), T129 (= T132), E156 (= E159), Y158 (= Y161), T274 (= T277), D278 (= D281), P314 (≠ A317)
- binding guanosine: T245 (= T248), S247 (= S250), E248 (= E251), A305 (= A308), I309 (= I312)
4kbeA Crystal structure of probable sugar kinase protein from rhizobium etli cfn 42 complexed with benzoguanamine
47% identity, 97% coverage: 7:327/332 of query aligns to 5:324/330 of 4kbeA
- active site: R125 (= R128), G275 (= G278), A276 (= A279), G277 (= G280), D278 (= D281)
- binding adenosine: N11 (= N13), I13 (= I15), D15 (= D17), M35 (= M37), G58 (= G61), G59 (= G62), S60 (= S63), N63 (= N66), M127 (= M130), T129 (= T132), E156 (= E159), Y158 (= Y161), D278 (= D281), P314 (≠ A317)
- binding 6-phenyl-1,3,5-triazine-2,4-diamine: I17 (≠ L19), S18 (≠ A20), R19 (≠ S21), P52 (= P55), A53 (≠ G56), L54 (≠ R57)
4kanA Crystal structure of probable sugar kinase protein from rhizobium etli cfn 42 complexed with 2-(2,5-dimethyl-1,3-thiazol-4-yl)acetic acid
47% identity, 97% coverage: 7:327/332 of query aligns to 5:324/330 of 4kanA
- active site: R125 (= R128), G275 (= G278), A276 (= A279), G277 (= G280), D278 (= D281)
- binding adenosine: N11 (= N13), I13 (= I15), D15 (= D17), M35 (= M37), G58 (= G61), G59 (= G62), S60 (= S63), N63 (= N66), M127 (= M130), T129 (= T132), E156 (= E159), Y158 (= Y161), T274 (= T277), D278 (= D281), P314 (≠ A317)
- binding (2,5-dimethyl-1,3-thiazol-4-yl)acetic acid: I16 (≠ V18), A43 (= A46), E44 (≠ D47), Y47 (= Y50), R114 (= R117), M116 (≠ L119), N215 (= N218), T245 (= T248), S247 (= S250), A276 (= A279)
4kalA Crystal structure of probable sugar kinase protein from rhizobium etli cfn 42 complexed with quinoline-3-carboxylic acid
47% identity, 97% coverage: 7:327/332 of query aligns to 5:324/330 of 4kalA
- active site: R125 (= R128), G275 (= G278), A276 (= A279), G277 (= G280), D278 (= D281)
- binding adenosine: N11 (= N13), I13 (= I15), D15 (= D17), M35 (= M37), G58 (= G61), G59 (= G62), N63 (= N66), M127 (= M130), T129 (= T132), E156 (= E159), Y158 (= Y161), T274 (= T277), D278 (= D281)
- binding quinoline-3-carboxylic acid: S190 (≠ V193), F191 (= F194), D194 (≠ N197), S221 (≠ A224), Q224 (≠ E227)
4kahA Crystal structure of probable sugar kinase protein from rhizobium etli cfn 42 complexed with 4-bromo-1h-pyrazole
47% identity, 97% coverage: 7:327/332 of query aligns to 5:324/330 of 4kahA
- active site: R125 (= R128), G275 (= G278), A276 (= A279), G277 (= G280), D278 (= D281)
- binding adenosine: N11 (= N13), I13 (= I15), D15 (= D17), M35 (= M37), G58 (= G61), G59 (= G62), S60 (= S63), N63 (= N66), M127 (= M130), T129 (= T132), E156 (= E159), Y158 (= Y161), T274 (= T277), D278 (= D281), P314 (≠ A317)
- binding 4-bromo-1H-pyrazole: I16 (≠ V18), Y47 (= Y50), L86 (= L89)
4kadA Crystal structure of probable sugar kinase protein from rhizobium etli cfn 42 complexed with n1-(2.3-dihydro-1h-inden-5-yl)acetam
47% identity, 97% coverage: 7:327/332 of query aligns to 5:324/330 of 4kadA
- active site: R125 (= R128), G275 (= G278), A276 (= A279), G277 (= G280), D278 (= D281)
- binding N-(4,7-dihydro-1H-inden-6-yl)acetamide: S247 (= S250), E248 (= E251), A305 (= A308), I309 (= I312)
- binding adenosine: N11 (= N13), I13 (= I15), D15 (= D17), M35 (= M37), G58 (= G61), G59 (= G62), S60 (= S63), N63 (= N66), M127 (= M130), T129 (= T132), E156 (= E159), Y158 (= Y161), T274 (= T277), D278 (= D281)
4k9iA Crystal structure of probable sugar kinase protein from rhizobium etli cfn 42 complexed with norharmane
47% identity, 97% coverage: 7:327/332 of query aligns to 5:324/330 of 4k9iA
- active site: R125 (= R128), G275 (= G278), A276 (= A279), G277 (= G280), D278 (= D281)
- binding adenosine: N11 (= N13), I13 (= I15), D15 (= D17), M35 (= M37), G58 (= G61), G59 (= G62), S60 (= S63), N63 (= N66), M127 (= M130), T129 (= T132), E156 (= E159), Y158 (= Y161), T274 (= T277), D278 (= D281)
- binding Norharmane: S190 (≠ V193), F191 (= F194), D194 (≠ N197), Q224 (≠ E227)
4k9cA Crystal structure of probable sugar kinase protein from rhizobium etli cfn 42 complexed with n-(hydroxymethyl)benzamide and 4-methyl-3,4- dihydro-2h-1,4-benzoxazine-7-carboxylic acid
47% identity, 97% coverage: 7:327/332 of query aligns to 5:324/330 of 4k9cA
- active site: R125 (= R128), G275 (= G278), A276 (= A279), G277 (= G280), D278 (= D281)
- binding N-(hydroxymethyl)benzamide: Y47 (= Y50), Q85 (= Q88), L86 (= L89), D88 (≠ A91), P111 (≠ S114), R114 (= R117)
- binding adenosine: N11 (= N13), I13 (= I15), D15 (= D17), M35 (= M37), G58 (= G61), G59 (= G62), S60 (= S63), N63 (= N66), M127 (= M130), T129 (= T132), E156 (= E159), Y158 (= Y161), T274 (= T277), D278 (= D281), P314 (≠ A317)
- binding 4-methyl-3,4-dihydro-2H-1,4-benzoxazine-7-carboxylic acid: S190 (≠ V193), F191 (= F194), D194 (≠ N197), Q224 (≠ E227)
4k93A Crystal structure of probable sugar kinase protein from rhizobium etli cfn 42 complexed with n-(hydroxymethyl)benzamide
47% identity, 97% coverage: 7:327/332 of query aligns to 5:324/330 of 4k93A
- active site: R125 (= R128), G275 (= G278), A276 (= A279), G277 (= G280), D278 (= D281)
- binding N-(hydroxymethyl)benzamide: L37 (= L39), I38 (= I40), Y47 (= Y50), Q85 (= Q88), D88 (≠ A91), R114 (= R117), L131 (= L134), D161 (= D164), S190 (≠ V193), F191 (= F194), D194 (≠ N197), R197 (≠ G200), L220 (= L223), S221 (≠ A224), Q224 (≠ E227), D226 (≠ E229), R234 (≠ K237)
- binding adenosine: N11 (= N13), I13 (= I15), D15 (= D17), M35 (= M37), G58 (= G61), G59 (= G62), S60 (= S63), N63 (= N66), M127 (= M130), T129 (= T132), E156 (= E159), Y158 (= Y161), T274 (= T277), D278 (= D281), P314 (≠ A317)
4k8tA Crystal structure of probable sugar kinase protein from rhizobium etli cfn 42 complexed with ethyl 3,4-diaminobenzoate
47% identity, 97% coverage: 7:327/332 of query aligns to 5:324/330 of 4k8tA
- active site: R125 (= R128), G275 (= G278), A276 (= A279), G277 (= G280), D278 (= D281)
- binding adenosine: N11 (= N13), I13 (= I15), D15 (= D17), M35 (= M37), G58 (= G61), G59 (= G62), S60 (= S63), N63 (= N66), M127 (= M130), T129 (= T132), E156 (= E159), Y158 (= Y161), T274 (= T277), D278 (= D281), P314 (≠ A317)
- binding ethyl 3,4-diaminobenzoate: F109 (≠ S112), P111 (≠ S114), R114 (= R117), Y130 (≠ F133)
4k8cA Crystal structure of probable sugar kinase protein from rhizobium etli cfn 42 complexed with adp
47% identity, 97% coverage: 7:327/332 of query aligns to 5:324/330 of 4k8cA
- active site: R125 (= R128), G275 (= G278), A276 (= A279), G277 (= G280), D278 (= D281)
- binding adenosine: N11 (= N13), I13 (= I15), D15 (= D17), M35 (= M37), G58 (= G61), G59 (= G62), N63 (= N66), M127 (= M130), T129 (= T132), E156 (= E159), Y158 (= Y161), T274 (= T277), D278 (= D281)
- binding adenosine-5'-diphosphate: N215 (= N218), T245 (= T248), S247 (= S250), E248 (= E251), G250 (= G253), A264 (= A267), A276 (= A279), G277 (= G280), C302 (≠ A305), A305 (= A308), I309 (= I312)
4jkuA Crystal structure of probable sugar kinase protein from rhizobium etli cfn 42 complexed with quinaldic acid, nysgrc target 14306
47% identity, 97% coverage: 7:327/332 of query aligns to 5:324/330 of 4jkuA
- active site: R125 (= R128), G275 (= G278), A276 (= A279), G277 (= G280), D278 (= D281)
- binding adenosine: N11 (= N13), I13 (= I15), D15 (= D17), M35 (= M37), G58 (= G61), G59 (= G62), S60 (= S63), N63 (= N66), M127 (= M130), T129 (= T132), E156 (= E159), Y158 (= Y161), T274 (= T277), D278 (= D281)
- binding quinoline-2-carboxylic acid: S190 (≠ V193), F191 (= F194), D194 (≠ N197), S221 (≠ A224), Q224 (≠ E227)
1liiA Structure of t. Gondii adenosine kinase bound to adenosine 2 and amp- pcp (see paper)
30% identity, 93% coverage: 8:316/332 of query aligns to 5:326/331 of 1liiA
- active site: R126 (= R128), D291 (= D281)
- binding phosphomethylphosphonic acid adenylate ester: R126 (= R128), T251 (= T248), G253 (≠ S250), H254 (≠ E251), V275 (≠ P269), T286 (= T276), N287 (≠ T277), G288 (= G278), A289 (= A279), G290 (= G280), D291 (= D281), N315 (≠ A305), A318 (= A308), Q319 (≠ A309)
- binding adenosine: N10 (= N13), I12 (= I15), D14 (= D17), G58 (= G61), G59 (= G62), S60 (= S63), C117 (= C118), T130 (= T132), Y159 (≠ L162), N287 (≠ T277), D291 (= D281)
1lijA Structure of t. Gondii adenosine kinase bound to prodrug 2 7- iodotubercidin and amp-pcp (see paper)
29% identity, 93% coverage: 8:316/332 of query aligns to 5:325/330 of 1lijA
- active site: R126 (= R128), D290 (= D281)
- binding phosphomethylphosphonic acid adenylate ester: R126 (= R128), T250 (= T248), G252 (≠ S250), H253 (≠ E251), V274 (≠ P269), G287 (= G278), A288 (= A279), G289 (= G280), N314 (≠ A305), A317 (= A308), Q318 (≠ A309)
- binding 2-ribofuranosyl-3-iodo-2,3-dihydro-1h-pyrazolo[3,4-d]pyrimidin-4-ylamine: N10 (= N13), D14 (= D17), T35 (≠ Q38), G59 (= G62), S60 (= S63), N63 (= N66), T130 (= T132), Y159 (≠ L162), D290 (= D281)
1dgmA Crystal structure of adenosine kinase from toxoplasma gondii (see paper)
30% identity, 95% coverage: 2:316/332 of query aligns to 1:336/346 of 1dgmA
- active site: R127 (= R128), G298 (= G278), A299 (= A279), G300 (= G280), D301 (= D281)
- binding adenosine: N11 (= N13), D15 (= D17), G60 (= G62), S61 (= S63), Y160 (≠ L162), D301 (= D281)
- binding magnesium ion: A176 (= A179), I179 (≠ A182), A182 (≠ K185)
2aa0A Crystal structure of t. Gondii adenosine kinase complexed with 6- methylmercaptopurine riboside (see paper)
28% identity, 95% coverage: 2:316/332 of query aligns to 1:344/351 of 2aa0A
- active site: R127 (= R128), G306 (= G278), A307 (= A279), G308 (= G280), D309 (= D281)
- binding 2-hydroxymethyl-5-(6-methylsulfanyl-purin-9-yl)-tetrahydro-furan-3,4-diol: N11 (= N13), I13 (= I15), D15 (= D17), G60 (= G62), N64 (= N66), T131 (= T132), L133 (= L134), Y160 (≠ L162), G271 (≠ S250), H272 (≠ E251), V293 (≠ P269), V296 (vs. gap), A307 (= A279), G308 (= G280), D309 (= D281), N333 (≠ A305), A336 (= A308), Q337 (≠ A309)
Sites not aligning to the query:
Query Sequence
>Ga0059261_1055 FitnessBrowser__Korea:Ga0059261_1055
VTAPVHDVVAIGNAIVDVLASAEDSFIEEIGVAKGSMQLIFSAEDADALYDRMGPGREIS
GGSAGNTVAGMAALGSRCAFIGQVADDQLGAVFAHDLRATGVDFDTEVRPGSPSTARCLI
FVTPDGQRTMNTFLGASQFLPEKALDRDLIAGGAILYLEGYLWDPEEPRQAMRAAIDIAR
GAGRKVAFTLSDVFCINRHGGDFRILIGDGLIDILFANENELLALAEVEDFEAAVAKIAA
QVPVLVVTRSEKGAIAISNGTRAEVPAEPIEKVVDTTGAGDLFAAGFLHGQAQGWTLDKS
LKLGAVCAAEIISHYGARPEVDLKALAAAKLG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory