Comparing Ga0059261_1166 FitnessBrowser__Korea:Ga0059261_1166 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3ut0A Crystal structure of exo-1,3/1,4-beta-glucanase (exop) from pseudoalteromonas sp. Bb1 (see paper)
46% identity, 92% coverage: 44:811/834 of query aligns to 4:782/804 of 3ut0A
6jg1A Crystal structure of barley exohydrolasei wildtype in complex with 4i, 4iii,4v-s-trithiocellohexaose (see paper)
45% identity, 70% coverage: 57:638/834 of query aligns to 16:601/606 of 6jg1A
3wlpA Crystal structure analysis of plant exohydrolase (see paper)
45% identity, 70% coverage: 57:638/834 of query aligns to 12:597/602 of 3wlpA
3wljA Crystal structure of barley beta-d-glucan glucohydrolase isoenzyme exo1 in complex with 3-deoxy-glucose (see paper)
45% identity, 70% coverage: 57:638/834 of query aligns to 12:597/602 of 3wljA
1x39A Crystal structure of barley beta-d-glucan glucohydrolase isoenzyme exo1 in complex with gluco-phenylimidazole (see paper)
45% identity, 70% coverage: 57:638/834 of query aligns to 12:597/602 of 1x39A
1x38A Crystal structure of barley beta-d-glucan glucohydrolase isoenzyme exo1 in complex with gluco-phenylimidazole (see paper)
45% identity, 70% coverage: 57:638/834 of query aligns to 12:597/602 of 1x38A
1lq2A Crystal structure of barley beta-d-glucan glucohydrolase isoenzyme exo1 in complex with gluco-phenylimidazole (see paper)
45% identity, 70% coverage: 57:638/834 of query aligns to 12:597/602 of 1lq2A
1j8vA Crystal structure of barley beta-d-glucan glucohydrolase isoenzyme exo1 in complex with 4'-nitrophenyl 3i-thiolaminaritrioside (see paper)
45% identity, 70% coverage: 57:638/834 of query aligns to 12:597/602 of 1j8vA
1iewA Crystal structure of barley beta-d-glucan glucohydrolase isoenzyme exo1 in complex with 2-deoxy-2-fluoro-alpha-d-glucoside (see paper)
45% identity, 70% coverage: 57:638/834 of query aligns to 12:597/602 of 1iewA
1ievA Crystal structure of barley beta-d-glucan glucohydrolase isoenzyme exo1 in complex with cyclohexitol (see paper)
45% identity, 70% coverage: 57:638/834 of query aligns to 12:597/602 of 1ievA
1ex1A Beta-d-glucan exohydrolase from barley (see paper)
45% identity, 70% coverage: 57:638/834 of query aligns to 12:597/602 of 1ex1A
6jgaA Crystal structure of barley exohydrolasei w286f in complex with 4'- nitrophenyl thiolaminaribioside (see paper)
45% identity, 70% coverage: 57:638/834 of query aligns to 16:601/606 of 6jgaA
6jg7A Crystal structure of barley exohydrolasei w286f in complex with methyl 2-thio-beta-sophoroside (see paper)
45% identity, 70% coverage: 57:638/834 of query aligns to 16:601/606 of 6jg7A
6jg2A Crystal structure of barley exohydrolasei wildtype in complex with 4'- nitrophenyl thiolaminaribioside (see paper)
45% identity, 70% coverage: 57:638/834 of query aligns to 14:598/603 of 6jg2A
6jg6A Crystal structure of barley exohydrolasei w286a mutant in complex with methyl 6-thio-beta-gentiobioside (see paper)
45% identity, 70% coverage: 57:638/834 of query aligns to 16:601/606 of 6jg6A
5m6gA Crystal structure glucan 1,4-beta-glucosidase from saccharopolyspora erythraea
46% identity, 71% coverage: 47:638/834 of query aligns to 5:576/579 of 5m6gA
5jp0A Bacteroides ovatus xyloglucan pul gh3b with bound glucose (see paper)
30% identity, 79% coverage: 49:704/834 of query aligns to 2:688/745 of 5jp0A
3u48B From soil to structure: a novel dimeric family 3-beta-glucosidase isolated from compost using metagenomic analysis
29% identity, 69% coverage: 64:638/834 of query aligns to 9:616/742 of 3u48B
Sites not aligning to the query:
7zgzX Crystal structure of beta-xylosidase from thermotoga maritima in complex with methyl-beta-d-xylopyranoside hydrolysed to xylose
29% identity, 71% coverage: 47:638/834 of query aligns to 5:611/753 of 7zgzX
5z9sA Functional and structural characterization of a beta-glucosidase involved in saponin metabolism from intestinal bacteria (see paper)
33% identity, 59% coverage: 60:549/834 of query aligns to 4:475/765 of 5z9sA
Sites not aligning to the query:
>Ga0059261_1166 FitnessBrowser__Korea:Ga0059261_1166
MVPTGKPKLMFRLLSSAMLASLPVVMAATASARDDAAQAHPAMWPERRPTVPLDPAVELR
VADLLAKMSLEQKVGQIIQADIASVTPADVHRYHLGSVLNGGNSDPGGRYNAPPRDWLAA
ADAFYAASMQPNGALPRIPVIWGSDAVHGHNNVVGATLFPHNIGLGAARNPDLIRRIGEA
TAIEMRVTGLDWTFAPTLAVVRDDRWGRTYEGFGETPEIATAYAAPLIEGLQGKIGDKDW
LRGPHIIATAKHFLGDGGTRNGKDQGDTEIGEAGLRDLFSPPYLPALDAGVQSVMVSFSG
WNGAKMHGNKSLLTGVVKQRWNFDGFLVGDWNGHGQVAGCTATNCPQSAIAGLDMYMAPD
SWKALYEATLGQARDGTLPIDRLDDAVRRILRVKIRAGLFEAGKPSSRPYAGRYELLGSA
EHRALAREAVRQSLVLLKNANGLLPLKPGGRILVAGDGADNLTKQTGGWTLSWQGTGTQR
SDFPNAQSIWEGIEATVKAAGGTATLSVEGGYSAKPDAAIVVFGEEPYAEFQGDRPDVGY
DDAKTLALLRTLKTAGVPTVAVFLSGRAMWVNPFLNASDAFVAAWLPGSEGGGVADVLFG
KSDFSGKLGYSWPRSSDQTTVNIGDSNYDPLFPYGFGLKVADRGDLAALPETRATAAAAE
TGILFTAGKPGGGRRLLLGRPGELAANPGPELIDARPADRSAQEDSLRIRWTGAGQAVAA
IVQDVPVDLSRQANGDLALELELKVNAAPSAEVSLLMRCGTDCAGGFPVRGILGEAAKTG
KWTRVAVPLRCFEKAGVDMTRVETPLSIATAGSLDLTLSSARITSPSGPQLACK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory