SitesBLAST
Comparing Ga0059261_1239 FitnessBrowser__Korea:Ga0059261_1239 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
D9J041 Mercuric reductase; Hg(II) reductase; EC 1.16.1.1 from Lysinibacillus sphaericus (Bacillus sphaericus) (see paper)
46% identity, 98% coverage: 12:479/479 of query aligns to 81:546/546 of D9J041
- C122 (= C53) modified: Disulfide link with 127, Redox-active
- C127 (= C58) modified: Disulfide link with 122, Redox-active
P16171 Mercuric reductase; Hg(II) reductase; EC 1.16.1.1 from Bacillus cereus (see paper)
46% identity, 97% coverage: 16:479/479 of query aligns to 170:631/631 of P16171
- Y264 (= Y112) mutation to F: 30-fold decrease in activity. 300-fold decrease in activity; when associated with F-605.
- Y605 (= Y453) mutation to F: 10-fold decrease in activity. 300-fold decrease in activity; when associated with F-264.; mutation to H: 2-fold decrease in activity.
5x1yB Structure of mercuric reductase from lysinibacillus sphaericus (see paper)
46% identity, 95% coverage: 13:468/479 of query aligns to 1:454/454 of 5x1yB
- active site: A13 (≠ S25), V37 (≠ I49), C41 (= C53), C46 (= C58), S49 (= S61), A74 (= A88), G75 (≠ R89), Y178 (= Y192), E182 (= E196), A318 (= A332), A437 (≠ F451), Y439 (= Y453), E444 (= E458)
- binding flavin-adenine dinucleotide: I9 (≠ V21), G12 (= G24), I32 (= I44), E33 (≠ G45), R34 (≠ A46), G39 (= G51), T40 (= T52), C41 (= C53), G45 (= G57), C46 (= C58), K50 (= K62), A114 (= A129), T138 (= T152), G139 (= G153), Y178 (= Y192), R266 (= R280), G305 (= G319), D306 (= D320), F313 (= F327), V314 (= V328), A317 (= A331)
P00392 Mercuric reductase; Hg(II) reductase; EC 1.16.1.1 from Pseudomonas aeruginosa (see 2 papers)
46% identity, 96% coverage: 20:479/479 of query aligns to 103:561/561 of P00392
- A110 (≠ G27) binding
- G130 (= G47) binding
- T135 (= T52) binding
- C136 (= C53) modified: Disulfide link with 141, Redox-active
- C141 (= C58) modified: Disulfide link with 136, Redox-active
- K145 (= K62) binding
- A211 (= A129) binding
- D403 (= D320) binding
- V411 (= V328) binding
- C558 (= C476) binding
- C559 (= C477) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
4k7zA Crystal structure of the c136(42)a/c141(47)a double mutant of tn501 mera in complex with NADP and hg2+
46% identity, 96% coverage: 20:479/479 of query aligns to 9:467/467 of 4k7zA
- active site: G14 (≠ S25), I38 (= I49), A42 (≠ C53), A47 (≠ C58), S50 (= S61), V76 (≠ A88), P77 (≠ R89), V186 (≠ Y192), E190 (= E196), A321 (= A332), F439 (= F451), Y441 (= Y453), E446 (= E458), C464 (= C476), C465 (= C477)
- binding flavin-adenine dinucleotide: I10 (≠ V21), G11 (= G22), G13 (= G24), A15 (= A26), E34 (≠ G45), R35 (≠ A46), G40 (= G51), T41 (= T52), A42 (≠ C53), G46 (= G57), A47 (≠ C58), K51 (= K62), E116 (≠ T128), A117 (= A129), T146 (= T152), G147 (= G153), R269 (= R280), G308 (= G319), D309 (= D320), Q315 (= Q326), F316 (= F327), V317 (= V328), Y318 (= Y329)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S184 (≠ G190), S185 (≠ G191), V186 (≠ Y192), V187 (= V193), E190 (= E196), R207 (= R213), N208 (≠ S214), R213 (≠ E219), T267 (= T278), G268 (= G279), R269 (= R280), Q315 (= Q326), F316 (= F327), V346 (= V358)
4k8dA Crystal structure of the c558(464)a/c559(465)a double mutant of tn501 mera in complex with NADPH and hg2+
46% identity, 96% coverage: 20:479/479 of query aligns to 8:466/466 of 4k8dA
- active site: G13 (≠ S25), I37 (= I49), C41 (= C53), C46 (= C58), S49 (= S61), V75 (≠ A88), P76 (≠ R89), V185 (≠ Y192), E189 (= E196), A320 (= A332), F438 (= F451), Y440 (= Y453), E445 (= E458), A463 (≠ C476), A464 (≠ C477)
- binding flavin-adenine dinucleotide: I9 (≠ V21), G10 (= G22), G12 (= G24), A14 (= A26), E33 (≠ G45), R34 (≠ A46), G39 (= G51), T40 (= T52), C41 (= C53), G45 (= G57), C46 (= C58), K50 (= K62), E115 (≠ T128), A116 (= A129), T145 (= T152), G146 (= G153), R268 (= R280), G307 (= G319), D308 (= D320), F315 (= F327), V316 (= V328), Y317 (= Y329)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: S183 (≠ G190), S184 (≠ G191), V185 (≠ Y192), V186 (= V193), E189 (= E196), R206 (= R213), N207 (≠ S214), R212 (≠ E219), T266 (= T278), G267 (= G279), Q314 (= Q326), F315 (= F327), V345 (= V358)
4ywoA Mercuric reductase from metallosphaera sedula (see paper)
38% identity, 96% coverage: 12:470/479 of query aligns to 2:444/444 of 4ywoA
- active site: A15 (≠ S25), I39 (= I49), C43 (= C53), C48 (= C58), S51 (= S61), A174 (≠ Y192), E178 (= E196), G308 (≠ A332), H425 (≠ F451), F427 (≠ Y453), E432 (= E458)
- binding flavin-adenine dinucleotide: G12 (= G22), G14 (= G24), K36 (≠ A46), G41 (= G51), T42 (= T52), C43 (= C53), G47 (= G57), C48 (= C58), K52 (= K62), A110 (= A129), A133 (= A151), T134 (= T152), G135 (= G153), N154 (≠ S172), L175 (≠ V193), L263 (= L287), G295 (= G319), D296 (= D320), M302 (≠ Q326), L303 (≠ F327), E304 (≠ V328), A307 (= A331)
2eq6A Crystal structure of lipoamide dehydrogenase from thermus thermophilus hb8
40% identity, 95% coverage: 14:470/479 of query aligns to 2:454/460 of 2eq6A
- active site: V37 (≠ I49), C41 (= C53), C46 (= C58), T49 (≠ S61), A176 (≠ Y192), E180 (= E196), H435 (≠ F451), H437 (≠ Y453), E442 (= E458)
- binding flavin-adenine dinucleotide: I9 (≠ V21), G10 (= G22), G12 (= G24), P13 (≠ S25), G14 (≠ A26), E33 (≠ G45), A34 (= A46), G39 (= G51), V40 (≠ T52), C41 (= C53), G45 (= G57), C46 (= C58), K50 (= K62), F111 (≠ T128), A112 (= A129), A135 (= A151), T136 (= T152), G137 (= G153), S155 (= S172), R269 (≠ N283), D306 (= D320), L312 (≠ Q326), L313 (≠ F327), A314 (≠ V328), H315 (≠ Y329), Y344 (≠ F360)
Sites not aligning to the query:
1ebdA Dihydrolipoamide dehydrogenase complexed with the binding domain of the dihydrolipoamide acetylase (see paper)
36% identity, 92% coverage: 17:455/479 of query aligns to 5:442/455 of 1ebdA
- active site: P13 (≠ S25), L37 (≠ I49), C41 (= C53), C46 (= C58), S49 (= S61), N74 (≠ A88), V75 (≠ R89), Y180 (= Y192), E184 (= E196), S320 (≠ A332), H438 (≠ F451), H440 (≠ Y453)
- binding flavin-adenine dinucleotide: G10 (= G22), G12 (= G24), P13 (≠ S25), V32 (≠ I44), E33 (≠ G45), K34 (≠ A46), G39 (= G51), V40 (≠ T52), C41 (= C53), G45 (= G57), C46 (= C58), K50 (= K62), E112 (≠ T128), A113 (= A129), T141 (= T152), G142 (= G153), Y180 (= Y192), I181 (≠ V193), R268 (= R280), D308 (= D320), A314 (≠ Q326), L315 (≠ F327), A316 (≠ V328)
Sites not aligning to the query:
P11959 Dihydrolipoyl dehydrogenase; Dihydrolipoamide dehydrogenase; E3 component of pyruvate complex; EC 1.8.1.4 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see paper)
36% identity, 92% coverage: 17:455/479 of query aligns to 11:448/470 of P11959
- 39:47 (vs. 45:53, 44% identical) binding
- K56 (= K62) binding
- D314 (= D320) binding
- A322 (≠ V328) binding
2yquB Crystal structures and evolutionary relationship of two different lipoamide dehydrogenase(e3s) from thermus thermophilus
35% identity, 95% coverage: 16:472/479 of query aligns to 2:454/455 of 2yquB
- active site: P11 (≠ S25), L36 (≠ I49), C40 (= C53), C45 (= C58), S48 (= S61), G72 (= G83), V73 (≠ I84), V177 (≠ Y192), E181 (= E196), S314 (≠ A332), H432 (≠ F451), H434 (≠ Y453), E439 (= E458)
- binding carbonate ion: A310 (≠ V328), S314 (≠ A332), S423 (≠ T442), D426 (= D445)
- binding flavin-adenine dinucleotide: G8 (= G22), G10 (= G24), P11 (≠ S25), G12 (≠ A26), E31 (vs. gap), K32 (≠ G45), G38 (= G51), T39 (= T52), C40 (= C53), R42 (≠ N55), G44 (= G57), C45 (= C58), K49 (= K62), T110 (= T128), A111 (= A129), T137 (= T152), G138 (= G153), I178 (≠ V193), Y265 (≠ N283), G301 (= G319), D302 (= D320), M308 (≠ Q326), L309 (≠ F327), A310 (≠ V328), H311 (≠ Y329)
2yquA Crystal structures and evolutionary relationship of two different lipoamide dehydrogenase(e3s) from thermus thermophilus
35% identity, 95% coverage: 16:472/479 of query aligns to 2:454/455 of 2yquA
- active site: P11 (≠ S25), L36 (≠ I49), C40 (= C53), C45 (= C58), S48 (= S61), G72 (= G83), V73 (≠ I84), V177 (≠ Y192), E181 (= E196), S314 (≠ A332), H432 (≠ F451), H434 (≠ Y453), E439 (= E458)
- binding flavin-adenine dinucleotide: G8 (= G22), G10 (= G24), P11 (≠ S25), G12 (≠ A26), E31 (vs. gap), K32 (≠ G45), G38 (= G51), T39 (= T52), C40 (= C53), R42 (≠ N55), G44 (= G57), C45 (= C58), K49 (= K62), T110 (= T128), A111 (= A129), T137 (= T152), G138 (= G153), S157 (= S172), I178 (≠ V193), Y265 (≠ N283), G301 (= G319), D302 (= D320), M308 (≠ Q326), L309 (≠ F327), A310 (≠ V328)
2eq7A Crystal structure of lipoamide dehydrogenase from thermus thermophilus hb8 with psbdo
35% identity, 95% coverage: 16:469/479 of query aligns to 2:451/452 of 2eq7A
- active site: P11 (≠ S25), L36 (≠ I49), C40 (= C53), C45 (= C58), S48 (= S61), G72 (= G83), V73 (≠ I84), V177 (≠ Y192), E181 (= E196), S314 (≠ A332), H432 (≠ F451), H434 (≠ Y453), E439 (= E458)
- binding flavin-adenine dinucleotide: G10 (= G24), P11 (≠ S25), G12 (≠ A26), E31 (vs. gap), K32 (≠ G45), G38 (= G51), T39 (= T52), C40 (= C53), R42 (≠ N55), G44 (= G57), C45 (= C58), K49 (= K62), T110 (= T128), A111 (= A129), T137 (= T152), G138 (= G153), S157 (= S172), I178 (≠ V193), R262 (= R280), Y265 (≠ N283), D302 (= D320), M308 (≠ Q326), L309 (≠ F327), A310 (≠ V328), H311 (≠ Y329), Y341 (≠ F360)
- binding nicotinamide-adenine-dinucleotide: W146 (≠ I161), G174 (= G189), G176 (= G191), V177 (≠ Y192), I178 (≠ V193), E197 (≠ V211), Y198 (≠ F212), V231 (≠ Y245), V260 (≠ T278), G261 (= G279), R262 (= R280), M308 (≠ Q326), L309 (≠ F327), V339 (= V358)
P14218 Dihydrolipoyl dehydrogenase; Dihydrolipoamide dehydrogenase; E3 component of 2-oxoglutarate dehydrogenase complex; EC 1.8.1.4 from Pseudomonas fluorescens (see 2 papers)
34% identity, 95% coverage: 14:468/479 of query aligns to 3:466/478 of P14218
- 34:49 (vs. 45:53, 31% identical) binding
- C49 (= C53) modified: Disulfide link with 54, Redox-active
- C54 (= C58) modified: Disulfide link with 49, Redox-active
- K58 (= K62) binding
- G122 (≠ A129) binding
- D319 (= D320) binding
- A327 (≠ V328) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
5u8wA Dihydrolipoamide dehydrogenase (lpdg) from pseudomonas aeruginosa bound to nadh (see paper)
34% identity, 95% coverage: 14:468/479 of query aligns to 2:465/473 of 5u8wA
- active site: P13 (≠ S25), L44 (≠ I49), C48 (= C53), C53 (= C58), S56 (= S61), G82 (≠ A88), V83 (≠ R89), V190 (≠ Y192), E194 (= E196), S330 (≠ A332), F448 (= F451), H450 (≠ Y453), E455 (= E458)
- binding flavin-adenine dinucleotide: I9 (≠ V21), G12 (= G24), P13 (≠ S25), G14 (≠ A26), E33 (vs. gap), K34 (vs. gap), G46 (= G51), T47 (= T52), C48 (= C53), G52 (= G57), C53 (= C58), K57 (= K62), H120 (≠ T128), G121 (≠ A129), A149 (= A151), S150 (≠ T152), G151 (= G153), S170 (= S172), G317 (= G319), D318 (= D320), M324 (≠ Q326), L325 (≠ F327), A326 (≠ V328), H327 (≠ Y329), Y357 (≠ F360), H450 (≠ Y453), P451 (≠ L454)
- binding 1,4-dihydronicotinamide adenine dinucleotide: I186 (≠ L188), G189 (= G191), V190 (≠ Y192), I191 (≠ V193), E194 (= E196), E210 (≠ V211), A211 (≠ F212), L212 (≠ R213), A275 (= A277), V276 (≠ T278), G277 (= G279), R278 (= R280), M324 (≠ Q326), L325 (≠ F327), V355 (= V358), Y357 (≠ F360)
Sites not aligning to the query:
5u8vA Dihydrolipoamide dehydrogenase (lpdg) from pseudomonas aeruginosa bound to NAD+ (see paper)
34% identity, 95% coverage: 14:468/479 of query aligns to 1:464/472 of 5u8vA
- active site: P12 (≠ S25), L43 (≠ I49), C47 (= C53), C52 (= C58), S55 (= S61), G81 (≠ A88), V82 (≠ R89), V189 (≠ Y192), E193 (= E196), S329 (≠ A332), F447 (= F451), H449 (≠ Y453), E454 (= E458)
- binding flavin-adenine dinucleotide: I8 (≠ V21), G11 (= G24), P12 (≠ S25), G13 (≠ A26), E32 (vs. gap), G45 (= G51), T46 (= T52), C47 (= C53), G51 (= G57), C52 (= C58), K56 (= K62), H119 (≠ T128), G120 (≠ A129), A148 (= A151), S149 (≠ T152), G150 (= G153), S169 (= S172), I190 (≠ V193), R277 (= R280), G316 (= G319), D317 (= D320), M323 (≠ Q326), L324 (≠ F327), A325 (≠ V328), H326 (≠ Y329), H449 (≠ Y453), P450 (≠ L454)
- binding nicotinamide-adenine-dinucleotide: I185 (≠ L188), G186 (= G189), G188 (= G191), V189 (≠ Y192), I190 (≠ V193), L208 (= L210), E209 (≠ V211), A210 (≠ F212), V243 (≠ A244), V275 (≠ T278), G276 (= G279)
Sites not aligning to the query:
5u8uD Dihydrolipoamide dehydrogenase (lpdg) from pseudomonas aeruginosa (see paper)
34% identity, 95% coverage: 14:468/479 of query aligns to 5:468/477 of 5u8uD
- active site: P16 (≠ S25), L47 (≠ I49), C51 (= C53), C56 (= C58), S59 (= S61), G85 (≠ A88), V86 (≠ R89), V193 (≠ Y192), E197 (= E196), S333 (≠ A332), F451 (= F451), H453 (≠ Y453), E458 (= E458)
- binding flavin-adenine dinucleotide: I12 (≠ V21), G15 (= G24), P16 (≠ S25), G17 (≠ A26), E36 (vs. gap), K37 (vs. gap), G49 (= G51), T50 (= T52), C51 (= C53), G55 (= G57), C56 (= C58), K60 (= K62), H123 (≠ T128), G124 (≠ A129), A152 (= A151), S153 (≠ T152), G154 (= G153), I194 (≠ V193), R281 (= R280), G320 (= G319), D321 (= D320), M327 (≠ Q326), L328 (≠ F327), A329 (≠ V328), H330 (≠ Y329), H453 (≠ Y453), P454 (≠ L454)
Sites not aligning to the query:
3urhB Crystal structure of a dihydrolipoamide dehydrogenase from sinorhizobium meliloti 1021
35% identity, 94% coverage: 16:464/479 of query aligns to 1:456/465 of 3urhB
- active site: Y35 (≠ I49), C39 (= C53), C44 (= C58), S47 (= S61), V183 (≠ Y192), E187 (= E196), H443 (≠ F451), H445 (≠ Y453), E450 (= E458)
- binding flavin-adenine dinucleotide: I6 (≠ V21), G7 (= G22), G9 (= G24), P10 (≠ S25), G11 (≠ A26), E30 (≠ G45), K31 (≠ A46), G37 (= G51), T38 (= T52), C39 (= C53), G43 (= G57), C44 (= C58), K48 (= K62), T111 (= T128), G112 (≠ A129), A140 (= A151), T141 (= T152), G142 (= G153), I184 (≠ V193), R273 (= R280), G312 (= G319), D313 (= D320), M319 (≠ F327), L320 (≠ V328), A321 (≠ Y329), H322 (≠ M330)
2rabA Structure of glutathione amide reductase from chromatium gracile in complex with NAD (see paper)
34% identity, 91% coverage: 14:450/479 of query aligns to 2:430/451 of 2rabA
- active site: S13 (= S25), L37 (≠ I49), C41 (= C53), C46 (= C58), K49 (≠ S61), Y173 (= Y192), E177 (= E196), I310 (≠ A332)
- binding flavin-adenine dinucleotide: G10 (= G22), G12 (= G24), S13 (= S25), G14 (≠ A26), I32 (= I44), E33 (≠ G45), S34 (≠ A46), T40 (= T52), G45 (= G57), C46 (= C58), K49 (≠ S61), H110 (≠ T128), A111 (= A129), T135 (= T152), G136 (= G153), R258 (= R280), G297 (= G319), D298 (= D320), Q304 (= Q326), L305 (≠ F327), T306 (≠ V328)
- binding nicotinamide-adenine-dinucleotide: K49 (≠ S61), I169 (≠ L188), G172 (= G191), Y173 (= Y192), I174 (≠ V193), E177 (= E196), A193 (vs. gap), L194 (≠ F212), E195 (≠ R213), V227 (≠ Y245), V256 (≠ T278), G257 (= G279), Q304 (= Q326), V337 (= V358)
Sites not aligning to the query:
D0VWY5 Glutathione amide reductase; GAR; EC 1.8.1.16 from Marichromatium gracile (Chromatium gracile) (see 2 papers)
34% identity, 91% coverage: 14:450/479 of query aligns to 3:434/463 of D0VWY5
- Q3 (≠ K14) binding
- H4 (≠ K15) binding
- SG 14:15 (≠ SA 25:26) binding
- E34 (≠ G45) binding
- T41 (= T52) binding
- C42 (= C53) modified: Disulfide link with 47, Redox-active
- C47 (= C58) modified: Disulfide link with 42, Redox-active
- K50 (≠ S61) binding ; binding
- HA 113:114 (≠ TA 128:129) binding
- 174:180 (vs. 190:196, 57% identical) binding
- LE 197:198 (≠ FR 212:213) binding
- V230 (≠ Y245) binding
- G261 (= G279) binding
- D302 (= D320) binding
- Q308 (= Q326) binding
- QLT 308:310 (≠ QFV 326:328) binding
- V341 (= V358) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 binding
- 2:463 modified: mature protein, Glutathione amide reductase
- 437 active site, Proton acceptor; binding
Query Sequence
>Ga0059261_1239 FitnessBrowser__Korea:Ga0059261_1239
MSDCCNPVDRPQDKKYDLIVVGGGSAGFSAAITAAEQGAQVAVIGAGTIGGTCVNVGCVP
SKALIRAVESIHHANAAPMRFKGIEARARAADWGQVIAEKDALVSGLRQAKYADLLPLYN
NVAYHEGTARLVDNGVETGGRRFTADRIVIATGTRPAVPAIPGLPDVDALDSTTALDLTE
LPKSMIVLGGGYVGVELAQTFSRAGVDVTLVFRSRLLPEMEPEIGAALTDYLSSEGITVL
GNLAYQSVHKTAEGGAALTVLRDGVAEIIVAERLLLATGRAPNVEDLGLIEAGVKQTLSG
AIIVDDHMRTSVRGVYAAGDVTGRDQFVYMAAYGAKIAAKNALNGDSLRYDNSAMPSVVF
SDPQVASVGFTEAQAIAAGYAARTSTLPLENVPRALAARDTRGLIKLVADGRTRKLLGAH
ILAPEGADSIQTAAMALRCGLTIDDLVETIFPYLTTVEGLKLAAQAFDRDVNRLSCCAG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory