SitesBLAST
Comparing Ga0059261_1305 FitnessBrowser__Korea:Ga0059261_1305 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7k3pA The structure of the udp-glc/glcnac 4-epimerase from the human pathogen campylobacter jejuni
47% identity, 97% coverage: 6:327/331 of query aligns to 4:329/329 of 7k3pA
- binding nicotinamide-adenine-dinucleotide: G8 (= G10), G11 (= G13), Y12 (= Y14), I13 (= I15), D32 (= D34), N33 (= N35), S35 (≠ V37), G37 (= G39), D57 (≠ N54), L58 (≠ V55), F79 (= F76), A80 (= A77), I83 (≠ V80), N98 (= N95), Y147 (= Y144), K151 (= K148), Y175 (= Y171), N177 (= N173), V178 (= V174)
4twrA Structure of udp-glucose 4-epimerase from brucella abortus
43% identity, 95% coverage: 6:320/331 of query aligns to 4:316/325 of 4twrA
- active site: S117 (≠ T120), C118 (≠ A121), A119 (= A122), Y141 (= Y144), K145 (= K148), H184 (≠ T187), H189 (= H192)
- binding nicotinamide-adenine-dinucleotide: G8 (= G10), G11 (= G13), F12 (≠ Y14), I13 (= I15), D32 (= D34), N33 (= N35), L34 (= L36), S35 (≠ V37), T36 (= T38), G37 (= G39), D51 (≠ N54), I52 (≠ V55), F73 (= F76), A74 (= A77), A75 (≠ G78), N92 (= N95), S115 (= S118), K145 (= K148), Y168 (= Y171), A171 (≠ V174), H184 (≠ T187)
- binding zinc ion: E182 (≠ Q185), H184 (≠ T187), E187 (≠ A190), H189 (= H192)
2c20A Crystal structure of udp-glucose 4-epimerase
42% identity, 97% coverage: 5:326/331 of query aligns to 2:322/329 of 2c20A
- active site: T117 (= T120), A118 (= A121), A119 (= A122), Y141 (= Y144), K145 (= K148), H184 (≠ T187)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), Y11 (= Y14), I12 (= I15), D31 (= D34), N32 (= N35), Q34 (≠ V37), T35 (= T38), G36 (= G39), D51 (≠ N54), L52 (≠ V55), F73 (= F76), A74 (= A77), A75 (≠ G78), N92 (= N95), Y141 (= Y144), K145 (= K148), Y168 (= Y171), F169 (= F172), V171 (= V174), H184 (≠ T187)
- binding zinc ion: E182 (≠ Q185), H184 (≠ T187), E187 (≠ A190), H189 (= H192)
Q9SA77 UDP-arabinose 4-epimerase 1; UDP-D-xylose 4-epimerase 1; EC 5.1.3.5 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
42% identity, 97% coverage: 6:325/331 of query aligns to 73:403/419 of Q9SA77
- G275 (≠ K195) mutation to D: In mur4-1; 50% reduction in L-Ara in cell wall material.
- R304 (= R224) mutation to Q: In mur4-3; 50% reduction in L-Ara in cell wall material.
7xpqA Crystal structure of udp-glc/glcnac 4-epimerase with NAD/udp-glcnac (see paper)
40% identity, 97% coverage: 6:326/331 of query aligns to 4:337/343 of 7xpqA
- binding nicotinamide-adenine-dinucleotide: G8 (= G10), G11 (= G13), Y12 (= Y14), I13 (= I15), D32 (= D34), N33 (= N35), N36 (≠ T38), D62 (≠ A56), L63 (≠ D57), F84 (= F76), A85 (= A77), G86 (= G78), K88 (≠ V80), N103 (= N95), S126 (= S118), S128 (≠ T120), Y152 (= Y144), K156 (= K148), Y180 (= Y171), P183 (≠ V174)
- binding uridine-diphosphate-n-acetylglucosamine: N182 (= N173), N202 (≠ H192), L203 (= L193), T219 (≠ S209), Y221 (≠ F211), R234 (= R224), Y236 (= Y226), V275 (= V263), R298 (= R286), D301 (= D289)
7xpoA Crystal structure of udp-glc/glcnac 4-epimerase with NAD/udp-glc (see paper)
40% identity, 97% coverage: 6:326/331 of query aligns to 4:337/344 of 7xpoA
- binding nicotinamide-adenine-dinucleotide: G8 (= G10), G11 (= G13), Y12 (= Y14), I13 (= I15), D32 (= D34), N33 (= N35), N36 (≠ T38), D62 (≠ A56), L63 (≠ D57), F84 (= F76), A85 (= A77), G86 (= G78), K88 (≠ V80), N103 (= N95), S126 (= S118), S128 (≠ T120), Y152 (= Y144), K156 (= K148), Y180 (= Y171), P183 (≠ V174)
- binding uridine-5'-diphosphate-glucose: S128 (≠ T120), A129 (= A121), F181 (= F172), N182 (= N173), N202 (≠ H192), L203 (= L193), T219 (≠ S209), V220 (= V210), Y221 (≠ F211), R234 (= R224), Y236 (= Y226), V275 (= V263), R298 (= R286), D301 (= D289)
3enkA 1.9a crystal structure of udp-glucose 4-epimerase from burkholderia pseudomallei
42% identity, 97% coverage: 4:324/331 of query aligns to 5:332/340 of 3enkA
- active site: S127 (= S119), S128 (≠ T120), T130 (≠ A122), Y152 (= Y144), K156 (= K148)
- binding nicotinamide-adenine-dinucleotide: G11 (= G10), G14 (= G13), Y15 (= Y14), I16 (= I15), D35 (= D34), N36 (= N35), V38 (= V37), N39 (≠ T38), S40 (≠ G39), D62 (≠ N54), V63 (= V55), F84 (= F76), A85 (= A77), A86 (≠ G78), K88 (≠ V80), N103 (= N95), S126 (= S118), S128 (≠ T120), Y152 (= Y144), K156 (= K148), Y180 (= Y171), P183 (≠ V174)
- binding uridine-5'-diphosphate-glucose: T130 (≠ A122), N182 (= N173), N201 (≠ T191), N202 (≠ H192), L203 (= L193), R219 (≠ S209), V220 (= V210), F221 (= F211), R234 (= R224), Y236 (= Y226), V272 (= V263), R295 (= R286), D298 (= D289)
1hzjA Human udp-galactose 4-epimerase: accommodation of udp-n- acetylglucosamine within the active site (see paper)
38% identity, 97% coverage: 6:326/331 of query aligns to 4:338/345 of 1hzjA
- active site: S131 (≠ T120), A132 (= A121), T133 (≠ A122), Y156 (= Y144), K160 (= K148)
- binding nicotinamide-adenine-dinucleotide: G8 (= G10), G11 (= G13), Y12 (= Y14), I13 (= I15), D32 (= D34), N33 (= N35), H35 (≠ V37), N36 (≠ T38), D65 (≠ N54), I66 (≠ V55), F87 (= F76), A88 (= A77), G89 (= G78), K91 (≠ V80), S129 (= S118), S131 (≠ T120), Y156 (= Y144), K160 (= K148), Y184 (= Y171), P187 (≠ V174)
- binding uridine-diphosphate-n-acetylglucosamine: N186 (= N173), N206 (≠ H192), L207 (= L193), N223 (≠ S209), V224 (= V210), F225 (= F211), R238 (= R224), Y240 (= Y226), V276 (= V263), R299 (= R286), D302 (= D289)
1ek6A Structure of human udp-galactose 4-epimerase complexed with nadh and udp-glucose (see paper)
38% identity, 97% coverage: 6:326/331 of query aligns to 5:339/346 of 1ek6A
- active site: S132 (≠ T120), A133 (= A121), T134 (≠ A122), Y157 (= Y144), K161 (= K148)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G9 (= G10), G12 (= G13), Y13 (= Y14), I14 (= I15), D33 (= D34), N34 (= N35), H36 (≠ V37), N37 (≠ T38), D66 (≠ N54), I67 (≠ V55), F88 (= F76), A89 (= A77), G90 (= G78), K92 (≠ V80), S130 (= S118), S131 (= S119), S132 (≠ T120), Y157 (= Y144), K161 (= K148), Y185 (= Y171), P188 (≠ V174)
- binding uridine-5'-diphosphate-glucose: S132 (≠ T120), Y157 (= Y144), F186 (= F172), N187 (= N173), N207 (≠ H192), L208 (= L193), N224 (≠ S209), V225 (= V210), F226 (= F211), R239 (= R224), Y241 (= Y226), V277 (= V263), R300 (= R286), D303 (= D289)
Q14376 UDP-glucose 4-epimerase; Galactowaldenase; UDP-N-acetylgalactosamine 4-epimerase; UDP-GalNAc 4-epimerase; UDP-N-acetylglucosamine 4-epimerase; UDP-GlcNAc 4-epimerase; UDP-galactose 4-epimerase; EC 5.1.3.2; EC 5.1.3.7 from Homo sapiens (Human) (see 13 papers)
38% identity, 97% coverage: 6:326/331 of query aligns to 5:339/348 of Q14376
- GYI 12:14 (= GYI 13:15) binding
- DNFHN 33:37 (≠ DNLVT 34:38) binding
- N34 (= N35) to S: in GALAC3; peripheral; nearly normal activity towards UDP-galactose; dbSNP:rs121908046
- DI 66:67 (≠ NV 54:55) binding
- F88 (= F76) binding
- G90 (= G78) to E: in GALAC3; 800-fold decrease in UDP-galactose epimerization activity; dbSNP:rs28940882
- K92 (≠ V80) binding
- V94 (= V82) to M: in GALAC3; generalized; 30-fold decrease in UDP-galactose epimerization activity; 2-fold decrease in affinity for UDP-galactose; 24% of normal activity with respect to UDP-N-acetylgalactosamine; dbSNP:rs121908047
- D103 (≠ K91) to G: in GALAC3; 7-fold decrease in UDP-galactose epimerization activity; very mild decrease in activity towards UDP-N-acetylgalactosamine; dbSNP:rs28940883
- S132 (≠ T120) mutation to A: Loss of activity.
- SAT 132:134 (≠ TAA 120:122) binding
- Y157 (= Y144) active site, Proton acceptor; mutation to F: Loss of activity.
- K161 (= K148) binding
- A180 (≠ F166) to V: in dbSNP:rs3204468
- L183 (= L169) to P: in GALAC3; peripheral; 3-fold decrease in UDP-galactose epimerization activity; dbSNP:rs121908045
- Y185 (= Y171) binding
- YFN 185:187 (= YFN 171:173) binding
- NNL 206:208 (≠ THL 191:193) binding
- NVF 224:226 (≠ SVF 209:211) binding
- R239 (= R224) binding
- K257 (≠ L242) to R: in GALAC3; 7-fold decrease in UDP-galactose epimerization activity; does not affect affinity for UDP-galactose; dbSNP:rs28940884
- REGD 300:303 (≠ RAGD 286:289) binding
- C307 (≠ L293) mutation to Y: No effect on activity towards UDP-galactose. Loss of activity towards UDP-N-acetylgalactosamine.
- L313 (≠ A299) to M: in GALAC3; 6-fold decrease in UDP-galactose epimerization activity; very mild decrease in activity towards UDP-N-acetylgalactosamine; dbSNP:rs3180383
- G319 (≠ P305) to E: in GALAC3; nearly normal activity towards UDP-galactose; mild impairment under conditions of substrate limitation; dbSNP:rs28940885
- R335 (≠ A322) to H: in GALAC3; 2-fold decrease in UDP-galactose epimerization activity; dbSNP:rs368637540
1gy8C Trypanosoma brucei udp-galactose 4' epimerase (see paper)
39% identity, 97% coverage: 6:325/331 of query aligns to 5:363/370 of 1gy8C
- active site: S144 (≠ T120), A145 (= A121), A146 (= A122), Y170 (= Y144), K174 (= K148)
- binding nicotinamide-adenine-dinucleotide: G9 (= G10), G12 (= G13), Y13 (= Y14), I14 (= I15), D34 (= D34), S35 (≠ N35), L36 (= L36), V37 (= V37), G38 (≠ T38), D77 (≠ N54), V78 (= V55), M100 (≠ F76), C101 (≠ A77), A102 (≠ G78), L104 (≠ V80), N119 (= N95), S142 (= S118), S143 (= S119), S144 (≠ T120), Y170 (= Y144), K174 (= K148), Y197 (= Y171), A200 (≠ V174)
- binding uridine-5'-diphosphate: N199 (= N173), H218 (= H192), L219 (= L193), I222 (vs. gap), M241 (≠ V208), P242 (≠ S209), I243 (≠ V210), F244 (= F211), C255 (≠ G222), R257 (= R224), R324 (= R286), D327 (= D289)
1i3lA Molecular basis for severe epimerase-deficiency galactosemia: x-ray structure of the human v94m-substituted udp-galactose 4-epimerase (see paper)
38% identity, 97% coverage: 6:326/331 of query aligns to 4:338/347 of 1i3lA
- active site: S131 (≠ T120), A132 (= A121), T133 (≠ A122), Y156 (= Y144), K160 (= K148)
- binding galactose-uridine-5'-diphosphate: N186 (= N173), N206 (≠ H192), L207 (= L193), N223 (≠ S209), V224 (= V210), F225 (= F211), R238 (= R224), Y240 (= Y226), V276 (= V263), R299 (= R286), D302 (= D289)
- binding nicotinamide-adenine-dinucleotide: G8 (= G10), G11 (= G13), Y12 (= Y14), I13 (= I15), D32 (= D34), N33 (= N35), H35 (≠ V37), N36 (≠ T38), D65 (≠ N54), I66 (≠ V55), F87 (= F76), A88 (= A77), G89 (= G78), K91 (≠ V80), S129 (= S118), S130 (= S119), S131 (≠ T120), Y156 (= Y144), K160 (= K148), Y184 (= Y171), P187 (≠ V174)
1i3kA Molecular basis for severe epimerase-deficiency galactosemia: x-ray structure of the human v94m-substituted udp-galactose 4-epimerase (see paper)
38% identity, 97% coverage: 6:326/331 of query aligns to 4:338/347 of 1i3kA
- active site: S131 (≠ T120), A132 (= A121), T133 (≠ A122), Y156 (= Y144), K160 (= K148)
- binding nicotinamide-adenine-dinucleotide: G8 (= G10), G11 (= G13), Y12 (= Y14), I13 (= I15), D32 (= D34), N33 (= N35), H35 (≠ V37), N36 (≠ T38), D65 (≠ N54), I66 (≠ V55), F87 (= F76), A88 (= A77), G89 (= G78), K91 (≠ V80), S129 (= S118), S131 (≠ T120), Y156 (= Y144), K160 (= K148), Y184 (= Y171), P187 (≠ V174)
- binding uridine-5'-diphosphate-glucose: F185 (= F172), N186 (= N173), N206 (≠ H192), L207 (= L193), N223 (≠ S209), V224 (= V210), F225 (= F211), R238 (= R224), Y240 (= Y226), V276 (= V263), R299 (= R286), D302 (= D289)
2udpA Udp-galactose 4-epimerase complexed with udp-phenol (see paper)
39% identity, 97% coverage: 6:326/331 of query aligns to 3:331/338 of 2udpA
- active site: S124 (≠ T120), A125 (= A121), T126 (≠ A122), Y149 (= Y144), K153 (= K148), M189 (≠ S183)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), Y11 (= Y14), I12 (= I15), D31 (= D34), N32 (= N35), L33 (= L36), C34 (≠ V37), N35 (≠ T38), S36 (≠ G39), D58 (≠ N54), I59 (≠ V55), F80 (= F76), A81 (= A77), G82 (= G78), K84 (≠ V80), S122 (= S118), S124 (≠ T120), Y149 (= Y144), K153 (= K148), Y177 (= Y171)
- binding phenyl-uridine-5'-diphosphate: N179 (= N173), N199 (≠ H192), L200 (= L193), A216 (≠ S209), I217 (≠ V210), F218 (= F211), R231 (= R224), Y233 (= Y226), V269 (= V263), R292 (= R286), D295 (= D289)
1udcA Structure of udp-galactose-4-epimerase complexed with udp-mannose (see paper)
39% identity, 97% coverage: 6:326/331 of query aligns to 3:331/338 of 1udcA
- active site: S124 (≠ T120), A125 (= A121), T126 (≠ A122), Y149 (= Y144), K153 (= K148), M189 (≠ S183)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), Y11 (= Y14), I12 (= I15), D31 (= D34), N32 (= N35), C34 (≠ V37), N35 (≠ T38), S36 (≠ G39), D58 (≠ N54), I59 (≠ V55), F80 (= F76), A81 (= A77), G82 (= G78), K84 (≠ V80), S122 (= S118), Y149 (= Y144), K153 (= K148), Y177 (= Y171), P180 (≠ V174)
- binding uridine-5'-diphosphate-mannose: T126 (≠ A122), Y149 (= Y144), N179 (= N173), N199 (≠ H192), L200 (= L193), L215 (≠ V208), A216 (≠ S209), I217 (≠ V210), F218 (= F211), R231 (= R224), Y233 (= Y226), V269 (= V263), R292 (= R286)
P09147 UDP-glucose 4-epimerase; Galactowaldenase; UDP-galactose 4-epimerase; EC 5.1.3.2 from Escherichia coli (strain K12) (see 10 papers)
39% identity, 97% coverage: 6:326/331 of query aligns to 3:331/338 of P09147
- YI 11:12 (= YI 14:15) binding
- DNLCNS 31:36 (≠ DNLVTG 34:39) binding
- DI 58:59 (≠ NV 54:55) binding
- FAGLK 80:84 (≠ FAGSV 76:80) binding
- N99 (= N95) binding
- S124 (≠ T120) binding ; mutation to A: No major structural changes. Catalytic efficiency is very low and affinity binding is 21% of the wild-type enzyme.; mutation to T: No major structural changes. Catalytic efficiency is about 30% of that of the wild-type enzyme, and affinity binding is similar to that of the native enzyme.
- Y149 (= Y144) active site, Proton acceptor; binding ; mutation to F: No major structural changes. Catalytic efficiency is very low and affinity binding is 12% of the wild-type enzyme.
- K153 (= K148) binding ; mutation to A: Decreases the catalytic activity. Not reduced by sugars in the presence or absence of UMP. It contains very little NADH.; mutation to M: Decreases the catalytic activity. Not reduced by sugars in the presence or absence of UMP. It contains very little NADH.
- F178 (= F172) binding
- Y299 (≠ L293) mutation to C: Loss of epimerase activity with UDP-Gal by almost 5-fold, but it results in a gain of epimerase activity with uridine diphosphate N-acetylglucosamine (UDP-GlcNAc) by 230-fold with minimal changes in its three-dimensional structure.
1udaA Structure of udp-galactose-4-epimerase complexed with udp-4-deoxy-4- fluoro-alpha-d-galactose (see paper)
39% identity, 97% coverage: 6:326/331 of query aligns to 3:331/338 of 1udaA
- active site: S124 (≠ T120), A125 (= A121), T126 (≠ A122), Y149 (= Y144), K153 (= K148), M189 (≠ S183)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), Y11 (= Y14), I12 (= I15), D31 (= D34), N32 (= N35), L33 (= L36), C34 (≠ V37), N35 (≠ T38), S36 (≠ G39), D58 (≠ N54), I59 (≠ V55), F80 (= F76), A81 (= A77), G82 (= G78), K84 (≠ V80), S122 (= S118), Y149 (= Y144), K153 (= K148), Y177 (= Y171), P180 (≠ V174)
- binding uridine-5'-diphosphate-4-deoxy-4-fluoro-alpha-d-galactose: T126 (≠ A122), N179 (= N173), N199 (≠ H192), L200 (= L193), A216 (≠ S209), I217 (≠ V210), F218 (= F211), R231 (= R224), Y233 (= Y226), R292 (= R286), D295 (= D289), Y299 (≠ L293)
1naiA Udp-galactose 4-epimerase from escherichia coli, oxidized (see paper)
39% identity, 97% coverage: 6:326/331 of query aligns to 3:331/338 of 1naiA
- active site: S124 (≠ T120), A125 (= A121), T126 (≠ A122), Y149 (= Y144), K153 (= K148), M189 (≠ S183)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), Y11 (= Y14), I12 (= I15), D31 (= D34), N32 (= N35), L33 (= L36), C34 (≠ V37), N35 (≠ T38), S36 (≠ G39), D58 (≠ N54), I59 (≠ V55), F80 (= F76), A81 (= A77), G82 (= G78), K84 (≠ V80), Y149 (= Y144), K153 (= K148), Y177 (= Y171), P180 (≠ V174)
- binding 1,3-propandiol: N35 (≠ T38), K84 (≠ V80), E191 (≠ Q185), P193 (≠ T187)
- binding uridine-5'-diphosphate: N179 (= N173), N199 (≠ H192), L200 (= L193), L215 (≠ V208), A216 (≠ S209), R231 (= R224), Y233 (= Y226), R292 (= R286)
1lrjA Crystal structure of e. Coli udp-galactose 4-epimerase complexed with udp-n-acetylglucosamine (see paper)
39% identity, 97% coverage: 6:326/331 of query aligns to 3:331/338 of 1lrjA
- active site: S124 (≠ T120), A125 (= A121), T126 (≠ A122), Y149 (= Y144), K153 (= K148), M189 (≠ S183)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), Y11 (= Y14), I12 (= I15), D31 (= D34), N32 (= N35), L33 (= L36), C34 (≠ V37), N35 (≠ T38), S36 (≠ G39), D58 (≠ N54), I59 (≠ V55), F80 (= F76), A81 (= A77), G82 (= G78), K84 (≠ V80), Y149 (= Y144), K153 (= K148), Y177 (= Y171), P180 (≠ V174)
- binding uridine-diphosphate-n-acetylglucosamine: V86 (= V82), S124 (≠ T120), F178 (= F172), N179 (= N173), L200 (= L193), L215 (≠ V208), A216 (≠ S209), F218 (= F211), R231 (= R224), Y233 (= Y226), V269 (= V263), R292 (= R286), D295 (= D289)
1kvrA Udp-galactose 4-epimerase complexed with udp-phenol (see paper)
39% identity, 97% coverage: 6:326/331 of query aligns to 3:331/338 of 1kvrA
- active site: A124 (≠ T120), A125 (= A121), T126 (≠ A122), Y149 (= Y144), K153 (= K148), M189 (≠ S183)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), Y11 (= Y14), I12 (= I15), D31 (= D34), N32 (= N35), C34 (≠ V37), N35 (≠ T38), S36 (≠ G39), D58 (≠ N54), I59 (≠ V55), F80 (= F76), A81 (= A77), G82 (= G78), K84 (≠ V80), S122 (= S118), S123 (= S119), Y149 (= Y144), K153 (= K148), Y177 (= Y171), P180 (≠ V174)
- binding uridine-5'-diphosphate: N179 (= N173), N198 (≠ T191), N199 (≠ H192), L200 (= L193), A216 (≠ S209), I217 (≠ V210), F218 (= F211), R231 (= R224), Y233 (= Y226), V269 (= V263), R292 (= R286), D295 (= D289)
Query Sequence
>Ga0059261_1305 FitnessBrowser__Korea:Ga0059261_1305
MRDGAVMVTGGAGYIGSHAVLALLDAGWRVVVLDNLVTGFDWAVDPRANLVVANVADDDK
VRAAIREHGITAIMHFAGSVVVPESVSDPLKYYRNNTAASRSLIESAVAEGVKHFIFSST
AATYGIPKVVPVREDSPQLPINPYGMSKLMTEHMLRDVAAAHPLNFAALRYFNVAGADPQ
GRSGQSTAGATHLIKVAVEAATGKRDGVSVFGTDFATRDGTGVRDYIHVTDLAAAHVDAL
DLLVAEPRQSHFLNAGYGRGYSVLEVLDAVDRVTNVKIERRLEGRRAGDPDELISDNRAI
LEALPWRPKHDDLDRIVKDALAWERKLAERA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory