SitesBLAST
Comparing Ga0059261_1314 FitnessBrowser__Korea:Ga0059261_1314 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1ltvA Crystal structure of chromobacterium violaceum phenylalanine hydroxylase, structure with bound oxidized fe(iii) (see paper)
60% identity, 86% coverage: 16:262/288 of query aligns to 16:262/275 of 1ltvA
3tcyA Crystallographic structure of phenylalanine hydroxylase from chromobacterium violaceum (cpah) bound to phenylalanine in a site distal to the active site (see paper)
60% identity, 86% coverage: 16:262/288 of query aligns to 18:264/277 of 3tcyA
- active site: H132 (= H130), H137 (= H135), E178 (= E176), S197 (= S195)
- binding cobalt (ii) ion: H132 (= H130), H137 (= H135), E178 (= E176)
- binding phenylalanine: A152 (= A150), Y153 (= Y151), K159 (≠ R157), L169 (= L167), T248 (= T246), P250 (≠ E248), D251 (= D250), F252 (= F251)
4etlA Crystallographic structure of phenylalanine hydroxylase from chromobacterium violaceum f258a mutation (see paper)
60% identity, 86% coverage: 16:262/288 of query aligns to 18:264/277 of 4etlA
1ltzA Crystal structure of chromobacterium violaceum phenylalanine hydroxylase, structure has bound iron (iii) and oxidized cofactor 7, 8-dihydrobiopterin (see paper)
60% identity, 86% coverage: 16:262/288 of query aligns to 18:261/274 of 1ltzA
2v27B Structure of the cold active phenylalanine hydroxylase from colwellia psychrerythraea 34h (see paper)
41% identity, 75% coverage: 28:242/288 of query aligns to 17:230/272 of 2v27B
5jk8A Phenylalanine hydroxylase from dictyostelium - bh2, norleucine complex
36% identity, 74% coverage: 28:240/288 of query aligns to 144:358/390 of 5jk8A
- active site: H250 (= H130), H255 (= H135), E295 (= E176), S314 (= S195)
- binding fe (iii) ion: H250 (= H130), H255 (= H135), E295 (= E176)
- binding 7,8-dihydrobiopterin: L214 (≠ V94), A216 (≠ D96), F219 (= F99), S287 (= S168), Y290 (= Y171)
- binding norleucine: Y242 (= Y122), T243 (≠ L123), H250 (= H130), S314 (= S195), S315 (= S196)
- binding piperazine-n,n'-bis(2-ethanesulfonic acid): T203 (= T83), R226 (= R106), D266 (= D146)
Sites not aligning to the query:
5jk5A Phenylalanine hydroxylase from dictyostelium - bh2 complex
36% identity, 74% coverage: 28:240/288 of query aligns to 153:367/400 of 5jk5A
- active site: H259 (= H130), H264 (= H135), E304 (= E176), S323 (= S195)
- binding fe (iii) ion: H259 (= H130), H264 (= H135), E304 (= E176)
- binding 7,8-dihydrobiopterin: G221 (= G92), L222 (= L93), L223 (≠ V94), F228 (= F99), L229 (≠ F100), S296 (= S168), Y299 (= Y171)
- binding piperazine-n,n'-bis(2-ethanesulfonic acid): T212 (= T83), P271 (= P142), D275 (= D146)
Sites not aligning to the query:
5tpgA Optimization of spirocyclic proline tryptophanhydroxylase-1 inhibitors (see paper)
37% identity, 74% coverage: 28:240/288 of query aligns to 43:257/271 of 5tpgA
- active site: H149 (= H130), H154 (= H135), E194 (= E176), S213 (= S195)
- binding (3S)-8-(2-amino-6-{(1R)-1-[5-chloro-3'-(methylsulfonyl)[1,1'-biphenyl]-2-yl]-2,2,2-trifluoroethoxy}pyrimidin-4-yl)-2,8-diazaspiro[4.5]decane-3-carboxylic acid: Y112 (≠ L93), P115 (≠ D96), F118 (= F99), R134 (= R115), Y141 (= Y122), T142 (≠ L123), P143 (≠ Q124), E144 (= E125), A186 (≠ S168), Y189 (= Y171), E194 (= E176), S213 (= S195), S214 (= S196)
- binding fe (iii) ion: H149 (= H130), H154 (= H135), E194 (= E176)
7zikA Crystal structure of human tryptophan hydroxylase 1 in complex with inhibitor lp533401 (see paper)
37% identity, 74% coverage: 28:240/288 of query aligns to 48:262/275 of 7zikA
- binding fe (iii) ion: H154 (= H130), H159 (= H135), E199 (= E176)
- binding (2~{R})-2-azanyl-3-[4-[2-azanyl-6-[(1~{R})-1-[4-chloranyl-2-(3-methylpyrazol-1-yl)phenyl]-2,2,2-tris(fluoranyl)ethoxy]pyrimidin-4-yl]phenyl]propanoic acid: Y117 (≠ L93), R139 (= R115), Y146 (= Y122), T147 (≠ L123), H154 (= H130), A191 (≠ S168), F195 (≠ W172), E199 (= E176), G215 (= G192), S218 (= S195), S219 (= S196), C246 (≠ Y224), I248 (= I226)
8cjmA Crystal structure of human tryptophan hydroxylase 1 in complex with inhibitor km-07-047 (see paper)
37% identity, 74% coverage: 28:240/288 of query aligns to 52:266/279 of 8cjmA
- binding fe (iii) ion: H158 (= H130), H163 (= H135), E203 (= E176)
- binding 7-(cyclobutylmethyl)-3-ethyl-8-(5,6,7,8-tetrahydroimidazo[1,2-a]pyridin-2-ylmethyl)purine-2,6-dione: Y121 (≠ L93), L122 (≠ V94), P124 (≠ D96), F127 (= F99), T139 (≠ G111), P154 (= P126), H158 (= H130), E203 (= E176)
7zihA Crystal structure of human tryptophan hydroxylase 1 in complex with inhibitor ag-01-128 (see paper)
37% identity, 74% coverage: 28:240/288 of query aligns to 60:274/288 of 7zihA
- binding fe (iii) ion: H166 (= H130), H171 (= H135), E211 (= E176)
- binding 8-(1~{H}-benzimidazol-2-ylmethyl)-3-ethyl-7-(phenylmethyl)purine-2,6-dione: Y129 (≠ L93), L130 (≠ V94), P132 (≠ D96), F135 (= F99), T147 (≠ G111), P162 (= P126), H166 (= H130), E211 (= E176)
5l01A Tryptophan 5-hydroxylase in complex with inhibitor (3~{s})-8-[2- azanyl-6-[(1~{r})-1-(4-chloranyl-2-phenyl-phenyl)-2,2,2- tris(fluoranyl)ethoxy]pyrimidin-4-yl]-2,8-diazaspiro[4.5]decane-3- carboxylic acid (see paper)
37% identity, 74% coverage: 28:240/288 of query aligns to 55:269/283 of 5l01A
- active site: H161 (= H130), H166 (= H135), E206 (= E176), S225 (= S195)
- binding (3~{S})-8-[2-azanyl-6-[(1~{R})-1-(4-chloranyl-2-phenyl-phenyl)-2,2,2-tris(fluoranyl)ethoxy]pyrimidin-4-yl]-2,8-diazaspiro[4.5]decane-3-carboxylic acid: Y124 (≠ L93), P127 (≠ D96), R146 (= R115), Y153 (= Y122), T154 (≠ L123), P155 (≠ Q124), H161 (= H130), A198 (≠ S168), E206 (= E176), G222 (= G192), S225 (= S195), S226 (= S196)
- binding fe (iii) ion: H161 (= H130), H166 (= H135), E206 (= E176)
7ziiA Crystal structure of human tryptophan hydroxylase 1 in complex with inhibitor km-05-193 (see paper)
37% identity, 74% coverage: 28:240/288 of query aligns to 59:273/287 of 7ziiA
- binding fe (iii) ion: H165 (= H130), H170 (= H135), E210 (= E176)
- binding 8-(5~{H}-[1,3]dioxolo[4,5-f]benzimidazol-6-ylmethyl)-7-(phenylmethyl)-3-propyl-purine-2,6-dione: G127 (= G92), Y128 (≠ L93), L129 (≠ V94), P131 (≠ D96), F134 (= F99), P161 (= P126), H165 (= H130), E210 (= E176)
8cjlA Crystal structure of human tryptophan hydroxylase 1 in complex with inhibitor tpt-004 (see paper)
37% identity, 74% coverage: 28:240/288 of query aligns to 56:270/284 of 8cjlA
- binding fe (iii) ion: H162 (= H130), H167 (= H135), E207 (= E176)
- binding 3-ethyl-8-[(2-methyl-5~{H}-imidazo[2,1-b][1,3]thiazol-6-yl)methyl]-7-(oxetan-3-ylmethyl)purine-2,6-dione: G124 (= G92), Y125 (≠ L93), L126 (≠ V94), P128 (≠ D96), F131 (= F99), T143 (≠ G111), P158 (= P126), H162 (= H130), E207 (= E176)
8cjnA Crystal structure of human tryptophan hydroxylase 1 in complex with inhibitor km-06-070 (see paper)
37% identity, 74% coverage: 28:240/288 of query aligns to 63:277/291 of 8cjnA
- binding fe (iii) ion: H169 (= H130), H174 (= H135), E214 (= E176)
- binding 3-ethyl-7-[(4-phenylphenyl)methyl]-8-(5,6,7,8-tetrahydroimidazo[1,2-a]pyridin-2-ylmethyl)purine-2,6-dione: Y132 (≠ L93), L133 (≠ V94), P135 (≠ D96), F138 (= F99), Y152 (≠ F113), E164 (= E125), P165 (= P126), H169 (= H130), E214 (= E176)
8cjkA Crystal structure of human tryptophan hydroxylase 1 in complex with inhibitor km-06-098 (see paper)
37% identity, 74% coverage: 28:240/288 of query aligns to 63:277/291 of 8cjkA
- binding fe (iii) ion: H169 (= H130), H174 (= H135), E214 (= E176)
- binding 3-ethyl-8-[(2-methylimidazo[2,1-b][1,3]thiazol-6-yl)methyl]-7-[[4-(1-methylpyrazol-3-yl)phenyl]methyl]purine-2,6-dione: Y132 (≠ L93), L133 (≠ V94), P135 (≠ D96), F138 (= F99), P163 (≠ Q124), P165 (= P126), H169 (= H130), E214 (= E176)
Sites not aligning to the query:
7zifA Crystal structure of human tryptophan hydroxylase 1 in complex with inhibitor km-480 (see paper)
37% identity, 74% coverage: 28:240/288 of query aligns to 63:277/291 of 7zifA
- binding fe (iii) ion: H169 (= H130), H174 (= H135), E214 (= E176)
- binding (2R)-2-azanyl-5-[[2-[3-methyl-2,6-bis(oxidanylidene)-7-(phenylmethyl)purin-8-yl]sulfanyl-3H-benzimidazol-5-yl]amino]-5-oxidanylidene-pentanoic acid: Y132 (≠ L93), L133 (≠ V94), P135 (≠ D96), F138 (= F99), Y161 (= Y122), T162 (≠ L123), P165 (= P126), H169 (= H130), E214 (= E176)
5j6dA Discovery of acyl guanidine tryptophan hydroxylase-1 inhibitors (see paper)
37% identity, 74% coverage: 28:240/288 of query aligns to 65:279/292 of 5j6dA
- active site: H171 (= H130), H176 (= H135), E216 (= E176), S235 (= S195)
- binding 4-[(N-{[2-(3-methoxyphenoxy)-6-(piperidin-1-yl)phenyl]methyl}carbamimidoyl)carbamoyl]-L-phenylalanine: Y134 (≠ L93), L135 (≠ V94), R156 (= R115), Y163 (= Y122), T164 (≠ L123), P165 (≠ Q124), P167 (= P126), H171 (= H130), A208 (≠ S168), Y211 (= Y171), F212 (≠ W172), E216 (= E176), S235 (= S195), S236 (= S196), I265 (= I226)
- binding fe (iii) ion: H171 (= H130), H176 (= H135), E216 (= E176)
Sites not aligning to the query:
7zigA Crystal structure of human tryptophan hydroxylase 1 in complex with inhibitor km-05-060 (see paper)
37% identity, 74% coverage: 28:240/288 of query aligns to 58:272/285 of 7zigA
- binding fe (iii) ion: H164 (= H130), H169 (= H135), E209 (= E176)
- binding (2~{R})-2-azanyl-5-[[2-[[3-methyl-2,6-bis(oxidanylidene)-7-(phenylmethyl)purin-8-yl]methyl]-1~{H}-benzimidazol-5-yl]amino]-5-oxidanylidene-pentanoic acid: G126 (= G92), Y127 (≠ L93), L128 (≠ V94), P130 (≠ D96), F133 (= F99), T145 (≠ G111), Y156 (= Y122), T157 (≠ L123), P160 (= P126), H164 (= H130), E209 (= E176)
8cjiA Crystal structure of human tryptophan hydroxylase 1 in complex with inhibitor km-07-052 (see paper)
37% identity, 74% coverage: 28:240/288 of query aligns to 63:277/290 of 8cjiA
- binding fe (iii) ion: H169 (= H130), H174 (= H135), E214 (= E176)
- binding methyl (2~{S})-2-azanyl-3-[[3-[[3-ethyl-2,6-bis(oxidanylidene)-8-(5,6,7,8-tetrahydroimidazo[1,2-a]pyridin-2-ylmethyl)purin-7-yl]methyl]phenyl]carbonylamino]propanoate: Y132 (≠ L93), L133 (≠ V94), P135 (≠ D96), F138 (= F99), P163 (≠ Q124), P165 (= P126), H169 (= H130), E214 (= E176)
Query Sequence
>Ga0059261_1314 FitnessBrowser__Korea:Ga0059261_1314
MSNETHVLDRPPEGAAADWTIPQNWDAFTAEEHGVWDTLFERQIKLLPGRASKAYLHGLE
LLKLSDGGIPNFEELSERLVKLTGWQVVAVPGLVPDDVFFDHMANRRFVAGNFIRRPDQL
DYLQEPDVFHDVFGHVPMLADPVFADYMEAYGRGGGRAMELGALKQLSRLYWYTVEFGLI
EEAGDLRIYGSGIVSSSAESRFALESDSPNRIGFDLKRVMRTEYRIDDFQQNYFVIPSFE
TLLRATVETDFAPLYAEILAQPDIPIAEIVAGDRVITHGTQEYANSKA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory