Comparing Ga0059261_1453 FitnessBrowser__Korea:Ga0059261_1453 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8gy3C Cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans
27% identity, 94% coverage: 44:737/740 of query aligns to 12:720/732 of 8gy3C
Q0QLF2 Nicotinate dehydrogenase large molybdopterin subunit; NDH; Nicotinic acid hydroxylase large molybdopterin subunit; NAH; EC 1.17.1.5 from Eubacterium barkeri (Clostridium barkeri) (see 2 papers)
25% identity, 43% coverage: 209:524/740 of query aligns to 2:336/425 of Q0QLF2
Sites not aligning to the query:
3hrdE Crystal structure of nicotinate dehydrogenase (see paper)
25% identity, 43% coverage: 209:524/740 of query aligns to 1:335/420 of 3hrdE
Sites not aligning to the query:
3hrdA Crystal structure of nicotinate dehydrogenase (see paper)
25% identity, 43% coverage: 209:524/740 of query aligns to 1:335/420 of 3hrdA
Sites not aligning to the query:
1rm6A Structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica (see paper)
28% identity, 53% coverage: 216:607/740 of query aligns to 4:436/761 of 1rm6A
Sites not aligning to the query:
O33819 4-hydroxybenzoyl-CoA reductase subunit alpha; 4-HBCR subunit alpha; EC 1.1.7.1 from Thauera aromatica (see paper)
28% identity, 53% coverage: 216:607/740 of query aligns to 12:444/769 of O33819
Sites not aligning to the query:
8emtB Cryo-em analysis of the human aldehyde oxidase from liver (see paper)
25% identity, 34% coverage: 216:467/740 of query aligns to 489:750/1221 of 8emtB
Sites not aligning to the query:
P77489 Aldehyde oxidoreductase molybdenum-binding subunit PaoC; EC 1.2.99.6 from Escherichia coli (strain K12) (see 2 papers)
33% identity, 17% coverage: 607:735/740 of query aligns to 586:719/732 of P77489
Sites not aligning to the query:
5g5gC Escherichia coli periplasmic aldehyde oxidase (see paper)
33% identity, 17% coverage: 607:735/740 of query aligns to 586:719/731 of 5g5gC
Sites not aligning to the query:
3ax7A Bovine xanthine oxidase, protease cleaved form (see paper)
25% identity, 35% coverage: 212:467/740 of query aligns to 469:755/1225 of 3ax7A
Sites not aligning to the query:
3nvzC Crystal structure of bovine xanthine oxidase in complex with indole-3- aldehyde (see paper)
25% identity, 34% coverage: 216:467/740 of query aligns to 4:286/755 of 3nvzC
Sites not aligning to the query:
3nvvC Crystal structure of bovine xanthine oxidase in complex with arsenite (see paper)
25% identity, 34% coverage: 216:467/740 of query aligns to 4:286/755 of 3nvvC
Sites not aligning to the query:
3ns1C Crystal structure of bovine xanthine oxidase in complex with 6- mercaptopurine (see paper)
25% identity, 34% coverage: 216:467/740 of query aligns to 4:286/755 of 3ns1C
Sites not aligning to the query:
3etrC Crystal structure of xanthine oxidase in complex with lumazine (see paper)
25% identity, 34% coverage: 216:467/740 of query aligns to 4:286/755 of 3etrC
Sites not aligning to the query:
3sr6C Crystal structure of reduced bovine xanthine oxidase in complex with arsenite (see paper)
25% identity, 34% coverage: 216:467/740 of query aligns to 4:286/745 of 3sr6C
Sites not aligning to the query:
3nvyC Crystal structure of bovine xanthine oxidase in complex with quercetin (see paper)
25% identity, 34% coverage: 216:467/740 of query aligns to 4:286/756 of 3nvyC
Sites not aligning to the query:
3nvwC Crystal structure of bovine xanthine oxidase in complex with guanine (see paper)
25% identity, 34% coverage: 216:467/740 of query aligns to 4:286/756 of 3nvwC
Sites not aligning to the query:
3eub4 Crystal structure of desulfo-xanthine oxidase with xanthine (see paper)
25% identity, 34% coverage: 216:467/740 of query aligns to 4:286/756 of 3eub4
Sites not aligning to the query:
3b9jC Structure of xanthine oxidase with 2-hydroxy-6-methylpurine (see paper)
25% identity, 34% coverage: 216:467/740 of query aligns to 4:286/758 of 3b9jC
Sites not aligning to the query:
3amzA Bovine xanthine oxidoreductase urate bound form (see paper)
25% identity, 34% coverage: 216:467/740 of query aligns to 538:820/1291 of 3amzA
Sites not aligning to the query:
>Ga0059261_1453 FitnessBrowser__Korea:Ga0059261_1453
MERTGKGIDRRTLLIGGGAGIGLVLAWAVWPRAYVPNLSVRDKETAFGAWLKIAENGQVT
VAIPQCEYGQGVFTTLPQLLADQLGADWRMVGVEQAPLNPIYANSLALDALFPGVFPERL
KRIWAERNLAMLTGGSTSMRSFETPLRSAGAGARALLCKAAARRWGVDWQECDTANGHVV
HDQKRLRFGELAAEAAGEKLPDDLPFREGETGRLTGTPAPRLDGPGKVDGSANFAADIRL
PGMVFAALRQGPIGTVKLAAIDEAAAAKVPGMLHIVKNELWVATVANNWWAASQALDAIS
PRFEVAAKVESETIQAALDAALESDGERMASAGDLAPVFKDARVVAAEYRVGLALHAAIE
PICATAVWEEGRVRLWLPTQAPGFARDAVANVLGVSASDVVIHPMLAGGSFGQNLEHQAA
AQAALIAREVKKPVQLMWSRGETCVQDRFRPPAVGRMTARLGANGSISGWLAKIAAPRTG
HELARRLTGGGGATGAALATGGIGDAAAVAGARPPYRIPALAIDHHPVEIVVPTGYWRSG
AHSYTAFFTESFIDELAHVADIEAFSFRIAMLGGEPRLARCLSTVTSLGGWQGGLPGSGQ
GLACHAFGGSYIAVMAEASVGGDQRVQVDRLIAAVDCGRVVNPSVVEQQIEGGLIFGMAA
ALGATTGITANRPEARSFRDLELPRLADCPQIMVELIASDADPGGASELAVPPVAPAIAN
ALYAATGVRLRQLPLIPGGE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory