Comparing Ga0059261_1483 FitnessBrowser__Korea:Ga0059261_1483 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8gqnA X-ray structure of thiolase with coa
58% identity, 98% coverage: 6:394/395 of query aligns to 3:390/390 of 8gqnA
P45359 Acetyl-CoA acetyltransferase; Acetoacetyl-CoA thiolase; CaTHL; EC 2.3.1.9 from Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W) (see paper)
48% identity, 98% coverage: 6:392/395 of query aligns to 4:390/392 of P45359
4xl4A Crystal structure of thiolase from clostridium acetobutylicum in complex with coa (see paper)
48% identity, 98% coverage: 6:392/395 of query aligns to 4:390/392 of 4xl4A
6aqpA Aspergillus fumigatus cytosolic thiolase: acetylated enzyme in complex with coa and potassium ions
48% identity, 100% coverage: 1:394/395 of query aligns to 2:397/397 of 6aqpA
6aqpC Aspergillus fumigatus cytosolic thiolase: acetylated enzyme in complex with coa and potassium ions
48% identity, 100% coverage: 1:394/395 of query aligns to 2:399/399 of 6aqpC
Q4WCL5 Acetyl-CoA acetyltransferase erg10B, cytosolic; Acetoacetyl-CoA thiolase erg10B; ACAT; Cytosolic thiolase erg10B; CT; Ergosterol biosynthesis protein 10B; EC 2.3.1.9 from Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) (Neosartorya fumigata)
48% identity, 100% coverage: 1:394/395 of query aligns to 1:398/398 of Q4WCL5
1ou6A Biosynthetic thiolase from zoogloea ramigera in complex with acetyl-o- pantetheine-11-pivalate
48% identity, 99% coverage: 2:392/395 of query aligns to 1:390/392 of 1ou6A
2vu1A Biosynthetic thiolase from z. Ramigera. Complex of with o-pantheteine- 11-pivalate. (see paper)
48% identity, 99% coverage: 3:392/395 of query aligns to 1:389/391 of 2vu1A
2vu2A Biosynthetic thiolase from z. Ramigera. Complex with s-pantetheine-11- pivalate. (see paper)
48% identity, 98% coverage: 6:392/395 of query aligns to 2:387/389 of 2vu2A
1dm3A Acetylated biosynthetic thiolase from zoogloea ramigera in complex with acetyl-coa (see paper)
48% identity, 98% coverage: 6:392/395 of query aligns to 2:387/389 of 1dm3A
1dlvA Biosynthetic thiolase from zoogloea ramigera in complex with coa (see paper)
48% identity, 98% coverage: 6:392/395 of query aligns to 2:387/389 of 1dlvA
P07097 Acetyl-CoA acetyltransferase; Acetoacetyl-CoA thiolase; Beta-ketothiolase; EC 2.3.1.9 from Shinella zoogloeoides (Crabtreella saccharophila) (see 2 papers)
47% identity, 99% coverage: 1:392/395 of query aligns to 1:390/392 of P07097
P41338 Acetyl-CoA acetyltransferase; Acetoacetyl-CoA thiolase; Ergosterol biosynthesis protein 10; EC 2.3.1.9 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
49% identity, 98% coverage: 6:392/395 of query aligns to 5:396/398 of P41338
Sites not aligning to the query:
6bn2A Crystal structure of acetyl-coa acetyltransferase from elizabethkingia anophelis nuhp1
48% identity, 98% coverage: 6:392/395 of query aligns to 4:390/393 of 6bn2A
2wkuA Biosynthetic thiolase from z. Ramigera. The n316h mutant. (see paper)
47% identity, 98% coverage: 6:392/395 of query aligns to 2:387/389 of 2wkuA
1m1oA Crystal structure of biosynthetic thiolase, c89a mutant, complexed with acetoacetyl-coa (see paper)
47% identity, 98% coverage: 6:392/395 of query aligns to 3:388/390 of 1m1oA
P14611 Acetyl-CoA acetyltransferase; Acetoacetyl-CoA thiolase; Beta-ketothiolase; EC 2.3.1.9 from Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) (Ralstonia eutropha) (see paper)
50% identity, 98% coverage: 6:392/395 of query aligns to 4:391/393 of P14611
1wl4A Human cytosolic acetoacetyl-coa thiolase complexed with coa (see paper)
44% identity, 99% coverage: 3:392/395 of query aligns to 2:392/394 of 1wl4A
Q9BWD1 Acetyl-CoA acetyltransferase, cytosolic; Acetyl-CoA transferase-like protein; Cytosolic acetoacetyl-CoA thiolase; EC 2.3.1.9 from Homo sapiens (Human) (see 2 papers)
44% identity, 99% coverage: 3:392/395 of query aligns to 5:395/397 of Q9BWD1
4o9cC Crystal structure of beta-ketothiolase (phaa) from ralstonia eutropha h16 (see paper)
50% identity, 98% coverage: 6:392/395 of query aligns to 4:391/393 of 4o9cC
>Ga0059261_1483 FitnessBrowser__Korea:Ga0059261_1483
MSTDPVVIISYARTPMGSMQGVLSDATATELGAAAVGAAVERAGLKGEAVERIYMGCVLP
AGLGQAPARQAARKAGLPDHVEATTVNKMCGSGMQAAIMGAEALAAGSVDLLVAGGLESM
TNAPYLSMKHRSGARIGHDRLFDHMFLDGLEDAYEPGRAMGTFAEEIATEYQFTREAQDE
FAIASLMRAQKAQQTGGFDREITPVEIKTRKGVVTVDKDEQPAKADPSKIPTLKPAFAKD
GTITAANASSISDGAAALVLTRASVAERLGLDPVARIVSHAAHAHLPARFTTAPVFAMQK
ALGKAGWGIGDVDLFEVNEAFAVVAMIAMRDLSISHDVLNVNGGACALGHPVGASGARIL
ATLLAALQNSGQKRGLASLCIGGGEATAMAVELMH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory