Comparing Ga0059261_1516 FitnessBrowser__Korea:Ga0059261_1516 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q12390 Glutathione S-transferase 2; GST-II; EC 2.5.1.18 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
35% identity, 100% coverage: 1:209/210 of query aligns to 19:223/233 of Q12390
3ibhA Crystal structure of saccharomyces cerevisiae gtt2 in complex with glutathione (see paper)
35% identity, 100% coverage: 1:209/210 of query aligns to 1:205/208 of 3ibhA
3ergA Crystal structure of gtt2 from saccharomyces cerevisiae in complex with glutathione sulfnate (see paper)
35% identity, 100% coverage: 1:209/210 of query aligns to 1:205/208 of 3ergA
8agqA Crystal structure of anthocyanin-related gstf8 from populus trichocarpa in complex with (-)-catechin and glutathione (see paper)
30% identity, 99% coverage: 1:207/210 of query aligns to 2:203/213 of 8agqA
4g9hA Crystal structure of glutahtione s-transferase homolog from yersinia pestis, target efi-501894, with bound glutathione
29% identity, 100% coverage: 1:210/210 of query aligns to 3:195/202 of 4g9hA
4ri6A Crystal structure of poplar glutathione transferase f1 (see paper)
30% identity, 99% coverage: 1:207/210 of query aligns to 4:203/214 of 4ri6A
3uarA Crystal structure of glutathione transferase (target efi-501774) from methylococcus capsulatus str. Bath with gsh bound
31% identity, 100% coverage: 1:210/210 of query aligns to 2:195/203 of 3uarA
3touA Crystal structure of glutathione transferase (target efi-501058) from ralstonia solanacearum gmi1000 with gsh bound
28% identity, 99% coverage: 1:207/210 of query aligns to 2:196/212 of 3touA
P15214 Glutathione S-transferase GST-6.0; GST B1-1; EC 2.5.1.18 from Proteus mirabilis (see paper)
26% identity, 100% coverage: 1:210/210 of query aligns to 1:193/203 of P15214
1pmtA Glutathione transferase from proteus mirabilis (see paper)
26% identity, 100% coverage: 1:210/210 of query aligns to 1:193/201 of 1pmtA
6f01B Arabidopsis thaliana gstf9, gso3 and gsoh bound (see paper)
26% identity, 99% coverage: 1:207/210 of query aligns to 2:202/212 of 6f01B
6ezyB Arabidopsis thaliana gstf9, gsh and gsoh bound (see paper)
26% identity, 99% coverage: 1:207/210 of query aligns to 2:202/212 of 6ezyB
O80852 Glutathione S-transferase F9; AtGSTF9; AtGSTF7; GST class-phi member 9; EC 2.5.1.18 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
26% identity, 99% coverage: 1:207/210 of query aligns to 3:203/215 of O80852
4xt0A Crystal structure of beta-etherase ligf from sphingobium sp. Strain syk-6 (see paper)
26% identity, 91% coverage: 19:209/210 of query aligns to 21:237/243 of 4xt0A
Sites not aligning to the query:
4gltA Crystal structure of glutathione s-transferase mfla_2116 (target efi- 507160) from methylobacillus flagellatus kt with gsh bound
28% identity, 99% coverage: 1:207/210 of query aligns to 7:200/208 of 4gltA
5f06A Crystal structure of glutathione transferase f7 from populus trichocarpa (see paper)
28% identity, 99% coverage: 1:207/210 of query aligns to 2:203/213 of 5f06A
6m1tA Bacterial beta class sphingomonas chungbukensis glutathione s- transferase
29% identity, 100% coverage: 1:210/210 of query aligns to 1:193/201 of 6m1tA
Q64471 Glutathione S-transferase theta-1; GST class-theta-1; EC 2.5.1.18 from Mus musculus (Mouse) (see paper)
27% identity, 85% coverage: 1:178/210 of query aligns to 3:174/240 of Q64471
Sites not aligning to the query:
Q9FE46 Glutathione S-transferase F12; AtGSTF12; GST class-phi member 12; Glutathione S-transferase 26; Protein TRANSPARENT TESTA 19; EC 2.5.1.18 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
29% identity, 99% coverage: 1:207/210 of query aligns to 3:204/214 of Q9FE46
Sites not aligning to the query:
6srbB Crystal structure of glutathione transferase omega 3c from trametes versicolor (see paper)
30% identity, 81% coverage: 3:172/210 of query aligns to 21:169/233 of 6srbB
Sites not aligning to the query:
>Ga0059261_1516 FitnessBrowser__Korea:Ga0059261_1516
MKLYDAPWAPSPRRVRIFLAEKGIEVPREAIDLRSGEQLGDAYLLINPRGAVPALELDDG
EVLCESAAICRYFEALHPEPSLFGTTAIEIGRIESWTRRIEGDGYAAVVYVLRNTVPAFK
DRAIPDAGLSIAQIPELAERGAQMWDGFTRALDRRLEDREWIAGGGYSFADITALVTIDF
ARAAKLTVPERLVHLGRWHAEASARPSAQA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory