Comparing Ga0059261_1579 FitnessBrowser__Korea:Ga0059261_1579 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
5hqaA A glycoside hydrolase family 97 enzyme in complex with acarbose from pseudoalteromonas sp. Strain k8 (see paper)
51% identity, 95% coverage: 34:684/685 of query aligns to 1:660/662 of 5hqaA
5hq4A A glycoside hydrolase family 97 enzyme from pseudoalteromonas sp. Strain k8 (see paper)
51% identity, 95% coverage: 34:684/685 of query aligns to 1:660/662 of 5hq4A
2zq0A Crystal structure of susb complexed with acarbose (see paper)
42% identity, 94% coverage: 37:680/685 of query aligns to 6:687/704 of 2zq0A
2jkpA Structure of a family 97 alpha-glucosidase from bacteroides thetaiotaomicron in complex with castanospermine (see paper)
43% identity, 94% coverage: 37:680/685 of query aligns to 5:682/687 of 2jkpA
2jkeA Structure of a family 97 alpha-glucosidase from bacteroides thetaiotaomicron in complex with deoxynojirimycin (see paper)
43% identity, 94% coverage: 37:680/685 of query aligns to 5:682/687 of 2jkeA
3wfaA Catalytic role of the calcium ion in gh97 inverting glycoside hydrolase
42% identity, 94% coverage: 37:680/685 of query aligns to 6:685/702 of 3wfaA
G8JZS4 Glucan 1,4-alpha-glucosidase SusB; Alpha-glucosidase SusB; Glucoamylase SusB; Starch-utilization system protein B; EC 3.2.1.3 from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) (see paper)
42% identity, 94% coverage: 37:680/685 of query aligns to 26:721/738 of G8JZS4
2d73A Crystal structure analysis of susb (see paper)
42% identity, 94% coverage: 37:680/685 of query aligns to 5:700/717 of 2d73A
5e1qB Mutant (d415g) gh97 alpha-galactosidase in complex with gal-lac (see paper)
27% identity, 95% coverage: 31:682/685 of query aligns to 2:643/644 of 5e1qB
Q8A6L0 Retaining alpha-galactosidase; BtGH97b; Melibiase; EC 3.2.1.22 from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) (see paper)
27% identity, 98% coverage: 13:682/685 of query aligns to 1:661/662 of Q8A6L0
5xfmA Crystal structure of beta-arabinopyranosidase (see paper)
25% identity, 93% coverage: 39:677/685 of query aligns to 12:627/632 of 5xfmA
>Ga0059261_1579 FitnessBrowser__Korea:Ga0059261_1579
MSRLIVLTALTSMMALPALAQGVVQNTALKEGGATATSPDGKLRVTVTVDGDGRPHYAVA
RNGKPLIEPSRLGFLLTDAPKLERRFAIESQATSSADSTWEQPWGEWKTIRDRHTEFRVR
LKESTALARVMDVVFRIFDEGVGFRYEFPDQPNLKHANIADELTEFGLAGNGTAWWIPAG
EWNRYEYLYNRTPISEVGQAHTPITVKLEDGTHVAFHEAALVDYSGMWLRRVTGTRFKAQ
LSPGAGPAKVVKQGPFTTPWRTMVIADDAAGLYTGSRMTLNLNEPNKLGDVSWVKPGKFV
GVWWNMIKGKWSWARGPQHGATTANVKRYIDFAGANGIPGVLVEGWNVGWDGDWFGNGTE
MNFSGPTEDFDAKALAAYARSKGTALVGHHETGGSASHYDKQLDTAFAWSAAHGQKVVKT
GYVADAGQIGRVDPDGSEHREWHDGQWMSNHHLRVVLAAARHKISVDPHEPIKDTGLRRT
YPNWLAREGARGQEYMAWQGKNPPEHEANLVFTRMLSGPMDFTPGILSLKGEKDSDIPST
IAKQLAQYVVIYSPVQMAADEPEVYAKLMDAFQFIKDVPVDWADTRILNGEVGDYVTIAR
KDRNGADWYLGSVGDEQARNLEVTLDFLDPGKTYTAQIYRDAPDTRFDSDTRHKYVIETR
KVKRGDKLMLALAPGGGQAIRFAAK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory