SitesBLAST
Comparing Ga0059261_1580 FitnessBrowser__Korea:Ga0059261_1580 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3wy2A Crystal structure of alpha-glucosidase in complex with glucose (see paper)
51% identity, 90% coverage: 13:500/541 of query aligns to 1:491/535 of 3wy2A
- active site: D97 (= D109), R197 (= R209), D199 (= D211), E268 (= E275), H329 (= H337), D330 (= D338)
- binding beta-D-glucopyranose: D59 (= D71), Y62 (= Y74), H102 (= H114), R197 (= R209), D199 (= D211), E268 (= E275), H329 (= H337), D330 (= D338), R397 (= R405)
- binding glycerol: S101 (= S113), D169 (= D181), V170 (≠ L182), P175 (= P187), R178 (≠ Q190), Q179 (≠ N191), F203 (= F215), Y204 (≠ A216), H206 (= H218), D240 (≠ N247), P244 (= P251), E280 (≠ A287)
- binding magnesium ion: D20 (= D32), R22 (≠ N34), V26 (≠ I38), D28 (= D40)
3wy1A Crystal structure of alpha-glucosidase (see paper)
51% identity, 90% coverage: 13:500/541 of query aligns to 1:491/535 of 3wy1A
- active site: D97 (= D109), R197 (= R209), D199 (= D211), E268 (= E275), H329 (= H337), D330 (= D338)
- binding glycerol: S101 (= S113), D169 (= D181), V170 (≠ L182), F203 (= F215), Y204 (≠ A216), H206 (= H218)
- binding magnesium ion: D20 (= D32), D24 (= D36), V26 (≠ I38), D28 (= D40)
- binding (3R,5R,7R)-octane-1,3,5,7-tetracarboxylic acid: D59 (= D71), Y62 (= Y74), H102 (= H114), F144 (= F156), F163 (= F175), R197 (= R209), D199 (= D211), T200 (≠ A212), G225 (= G232), E268 (= E275), F294 (= F301), H329 (= H337), D330 (= D338), R397 (= R405)
3wy4A Crystal structure of alpha-glucosidase mutant e271q in complex with maltose (see paper)
51% identity, 90% coverage: 13:500/541 of query aligns to 1:491/535 of 3wy4A
- active site: D97 (= D109), R197 (= R209), D199 (= D211), Q268 (≠ E275), H329 (= H337), D330 (= D338)
- binding alpha-D-glucopyranose: D59 (= D71), Y62 (= Y74), H102 (= H114), I143 (≠ V155), F163 (= F175), D199 (= D211), T200 (≠ A212), G225 (= G232), Q268 (≠ E275), Q268 (≠ E275), F294 (= F301), H329 (= H337), D330 (= D338), R397 (= R405), R397 (= R405)
- binding glycerol: S101 (= S113), D169 (= D181), V170 (≠ L182), F203 (= F215), Y204 (≠ A216), H206 (= H218), L224 (≠ T231), G225 (= G232), A226 (≠ T233), P227 (= P234), F294 (= F301), D330 (= D338), E374 (≠ Q382), K395 (≠ L403), G396 (≠ S404), G399 (= G407)
- binding magnesium ion: D20 (= D32), D24 (= D36), V26 (≠ I38), D28 (= D40)
3wy4B Crystal structure of alpha-glucosidase mutant e271q in complex with maltose (see paper)
49% identity, 67% coverage: 13:377/541 of query aligns to 1:323/421 of 3wy4B
- active site: D75 (= D109), R175 (= R209), D177 (= D211), Q237 (≠ E275)
- binding glycerol: S79 (= S113), N140 (= N174), D147 (= D181), F181 (= F215), Y182 (≠ A216), F183 (≠ M217), H184 (= H218), D209 (≠ N247)
2ze0A Alpha-glucosidase gsj (see paper)
37% identity, 94% coverage: 14:520/541 of query aligns to 2:499/531 of 2ze0A
4m56A The structure of wild-type mall from bacillus subtilis (see paper)
37% identity, 90% coverage: 15:502/541 of query aligns to 1:510/555 of 4m56A
- active site: D95 (= D109), R195 (= R209), D197 (= D211), E250 (= E275), H326 (= H337), D327 (= D338)
- binding D-glucose: D57 (= D71), Y60 (= Y74), H100 (= H114), F142 (= F156), D197 (= D211), E250 (= E275), D327 (= D338), R413 (= R405)
8ibkA Crystal structure of bacillus sp. Ahu2216 gh13_31 alpha-glucosidase e256q/n258g in complex with maltotriose (see paper)
35% identity, 90% coverage: 14:501/541 of query aligns to 1:501/546 of 8ibkA
- binding calcium ion: D19 (= D32), N21 (= N34), D23 (= D36), I25 (= I38), D27 (= D40)
- binding alpha-D-glucopyranose: D58 (= D71), Y61 (= Y74), H101 (= H114), I141 (≠ V155), F161 (= F175), D197 (= D211), A198 (= A212), H201 (≠ F215), M227 (≠ L245), Q254 (≠ E275), Q254 (≠ E275), F280 (= F301), H320 (= H337), D321 (= D338), R405 (= R405)
Sites not aligning to the query:
5wczA Crystal structure of wild-type mall from bacillus subtilis with ts analogue 1-deoxynojirimycin (see paper)
37% identity, 90% coverage: 15:502/541 of query aligns to 1:510/556 of 5wczA
- active site: D95 (= D109), R195 (= R209), D197 (= D211), E250 (= E275), H326 (= H337), D327 (= D338)
- binding 1-deoxynojirimycin: D57 (= D71), Y60 (= Y74), H100 (= H114), F161 (= F175), D197 (= D211), V198 (≠ A212), E250 (= E275), H326 (= H337), D327 (= D338), R413 (= R405)
4mazA The structure of mall mutant enzyme v200s from bacillus subtilus (see paper)
37% identity, 90% coverage: 15:502/541 of query aligns to 1:513/559 of 4mazA
7lv6B The structure of mall mutant enzyme s536r from bacillus subtilis
37% identity, 90% coverage: 15:502/541 of query aligns to 1:513/559 of 7lv6B
O06994 Oligo-1,6-glucosidase 1; Dextrin 6-alpha-D-glucanohydrolase; Oligosaccharide alpha-1,6-glucosidase 1; Sucrase-isomaltase 1; Isomaltase 1; EC 3.2.1.10 from Bacillus subtilis (strain 168) (see paper)
37% identity, 90% coverage: 15:502/541 of query aligns to 3:515/561 of O06994
- D20 (= D32) binding
- N22 (= N34) binding
- D24 (= D36) binding
- F26 (≠ I38) binding
- D28 (= D40) binding
7p01A Structure of the maltase baag2 from blastobotrys adeninivorans in complex with acarbose (see paper)
34% identity, 98% coverage: 11:538/541 of query aligns to 2:570/572 of 7p01A
- binding 4,6-dideoxy-4-{[(1S,4R,5S,6S)-4,5,6-trihydroxy-3-(hydroxymethyl)cyclohex-2-en-1-yl]amino}-alpha-D-glucopyranose: D62 (= D71), Y65 (= Y74), H105 (= H114), Y150 (≠ V155), F170 (= F175), D207 (= D211), T208 (≠ A212), E265 (= E275), F291 (= F301), H338 (= H337), D339 (= D338), R431 (= R405), T529 (≠ G501), D530 (≠ K502)
- binding calcium ion: D23 (= D32), N25 (= N34), D27 (= D36), I29 (= I38), D31 (= D40)
- binding alpha-D-glucopyranose: R224 (≠ P229), F291 (= F301), A295 (vs. gap), E300 (vs. gap), S349 (vs. gap), D350 (= D348), D350 (= D348), A351 (= A349), Q427 (≠ L401), K428 (≠ T402)
- binding 1-methylpyrrolidin-2-one: S19 (≠ R28), I29 (= I38), M63 (≠ F72), H74 (≠ D83), W454 (= W429)
4h8vA Crystal structure of the trehalulose synthase mutb in complex with trehalulose
36% identity, 91% coverage: 16:507/541 of query aligns to 6:516/557 of 4h8vA
- active site: D99 (= D109), R198 (= R209), D200 (= D211), E254 (= E275), H326 (= H337), D327 (= D338)
- binding calcium ion: D22 (= D32), N24 (= N34), D26 (= D36), I28 (= I38), D30 (= D40)
- binding 1-O-alpha-D-glucopyranosyl-D-fructose: D61 (= D71), Y64 (= Y74), H104 (= H114), F164 (= F175), D200 (= D211), E254 (= E275), F256 (≠ G277), R284 (≠ Y305), R291 (vs. gap), H326 (= H337), D327 (= D338), E386 (vs. gap), R414 (= R405)
2pwdA Crystal structure of the trehalulose synthase mutb from pseudomonas mesoacidophila mx-45 complexed to the inhibitor deoxynojirmycin (see paper)
36% identity, 91% coverage: 16:507/541 of query aligns to 6:516/557 of 2pwdA
- active site: D99 (= D109), R198 (= R209), D200 (= D211), E254 (= E275), H326 (= H337), D327 (= D338)
- binding calcium ion: D22 (= D32), N24 (= N34), D26 (= D36), I28 (= I38), D30 (= D40)
- binding 1-deoxynojirimycin: D61 (= D71), Y64 (= Y74), H104 (= H114), F164 (= F175), D200 (= D211), E254 (= E275), H326 (= H337), D327 (= D338), R414 (= R405)
4aieA Structure of glucan-1,6-alpha-glucosidase from lactobacillus acidophilus ncfm (see paper)
35% identity, 90% coverage: 16:501/541 of query aligns to 3:496/537 of 4aieA
5do8B 1.8 angstrom crystal structure of listeria monocytogenes lmo0184 alpha-1,6-glucosidase (see paper)
34% identity, 97% coverage: 14:538/541 of query aligns to 2:549/553 of 5do8B
- active site: D97 (= D109), R193 (= R209), D195 (= D211), E252 (= E275), H325 (= H337), D326 (= D338)
- binding beta-D-glucopyranose: D59 (= D71), Y62 (= Y74), H102 (= H114), F159 (= F175), R193 (= R209), D195 (= D211), E252 (= E275), H325 (= H337), D326 (= D338), R411 (= R405)
2pwgA Crystal structure of the trehalulose synthase mutb from pseudomonas mesoacidophila mx-45 complexed to the inhibitor castanospermine (see paper)
36% identity, 91% coverage: 16:507/541 of query aligns to 5:515/556 of 2pwgA
- active site: D98 (= D109), R197 (= R209), D199 (= D211), E253 (= E275), H325 (= H337), D326 (= D338)
- binding calcium ion: D21 (= D32), N23 (= N34), D25 (= D36), I27 (= I38), D29 (= D40)
- binding castanospermine: D60 (= D71), Y63 (= Y74), H103 (= H114), F163 (= F175), D199 (= D211), E253 (= E275), D326 (= D338), R413 (= R405)
2pweA Crystal structure of the mutb e254q mutant in complex with the substrate sucrose (see paper)
36% identity, 91% coverage: 16:507/541 of query aligns to 5:515/556 of 2pweA
- active site: D98 (= D109), R197 (= R209), D199 (= D211), Q253 (≠ A274), H325 (= H337), D326 (= D338)
- binding calcium ion: D21 (= D32), N23 (= N34), D25 (= D36), I27 (= I38), D29 (= D40)
- binding beta-D-fructofuranose: F163 (= F175), Q253 (≠ A274), F255 (≠ V276), D326 (= D338), R413 (= R405)
- binding alpha-D-glucopyranose: D60 (= D71), Y63 (= Y74), H103 (= H114), F163 (= F175), D199 (= D211), Q253 (≠ A274), H325 (= H337), D326 (= D338), R413 (= R405)
2pwfA Crystal structure of the mutb d200a mutant in complex with glucose (see paper)
36% identity, 91% coverage: 16:507/541 of query aligns to 4:514/555 of 2pwfA
- active site: D97 (= D109), R196 (= R209), A198 (≠ D211), E252 (= E275), H324 (= H337), D325 (= D338)
- binding beta-D-glucopyranose: D59 (= D71), Y62 (= Y74), H102 (= H114), F162 (= F175), R196 (= R209), A198 (≠ D211), E252 (= E275), H324 (= H337), D325 (= D338), R412 (= R405)
- binding calcium ion: D20 (= D32), N22 (= N34), D24 (= D36), I26 (= I38), D28 (= D40)
4ha1A Mutb inactive double mutant d200a-d415n in complex with isomaltulose
36% identity, 91% coverage: 16:507/541 of query aligns to 5:515/556 of 4ha1A
- active site: D98 (= D109), R197 (= R209), A199 (≠ D211), E253 (= E275), H325 (= H337), D326 (= D338)
- binding calcium ion: D21 (= D32), N23 (= N34), D25 (= D36), I27 (= I38), D29 (= D40)
- binding 6-O-alpha-D-glucopyranosyl-D-fructose: D60 (= D71), Y63 (= Y74), H103 (= H114), F163 (= F175), E253 (= E275), R283 (≠ Y305), H325 (= H337), D326 (= D338), E385 (vs. gap), R413 (= R405)
Query Sequence
>Ga0059261_1580 FitnessBrowser__Korea:Ga0059261_1580
VSEAAPMPATETNRDWWRGAVIYQIYPRSFADSNGDGIGDLPGVAAHLDHVAALGADAIW
LSPFFTSPMRDFGYDIADYCGVDPVFGTLADFDAVIEKAHALGLKVIIDQVYSHTSDQHE
WFKESRSSRDNAKADWYVWADAKADGSPPTNWQSVFGGPAWTWDARRGQYYLHNFLSEQP
DLNLHNPQVQNAALAAARFWLDRGVDGFRVDAINFAMHDPEFRDNPPAPYTGTPRTRPFD
FQQHLYNQSHPDIVRFLERHRELTDSYGGRFTVAEVGGPTPEAEMHAFTQGQKRLNSAYG
FDFLYANKLTPALVKKAVETWPDTHGTGWPSWAFENHDAPRALSRWVDAEHRDAFAAMKM
LLLMCLRGNAILFQGEELGLTQVEIAYDQLQDPEAIANWPLTLSRDGVRTPMPWKADAEN
LGFTAGRPWLPLGPDHGALAVDRQIAQNGSLLNLTRGLIALRAANPALRAGAMEVLAADE
ALLVFTRIADGQALTCAFNLGKTPLAWHPAQPDRFRLLAAVNGAAPGSLPPYSGLVLEQI
A
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory