SitesBLAST
Comparing Ga0059261_1621 FitnessBrowser__Korea:Ga0059261_1621 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q53TZ2 L-arabinose 1-dehydrogenase (NAD(P)(+)); D-galactose 1-dehydrogenase; EC 1.1.1.376; EC 1.1.1.120; EC 1.1.1.48 from Azospirillum brasilense (see paper)
53% identity, 99% coverage: 2:305/307 of query aligns to 3:307/309 of Q53TZ2
- D169 (= D168) mutation to A: Loss of activity.
- N173 (= N172) mutation to A: Decrease by 4 orders of magnitude in catalytic efficiency.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
7cgqA Crystal structure of azospirillum brasilense l-arabinose 1- dehydrogenase e147a mutant (NADP and l-arabinose bound form)
53% identity, 99% coverage: 3:305/307 of query aligns to 1:304/306 of 7cgqA
- binding alpha-L-arabinopyranose: K88 (= K90), H116 (= H118), H150 (= H152), P167 (= P169), N170 (= N172)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G12), K11 (= K13), I12 (= I14), S34 (= S36), R35 (= R37), H36 (= H38), C64 (= C66), A65 (≠ T67), P66 (= P68), V69 (≠ G71), E87 (= E89), K88 (= K90), H116 (= H118), Q153 (= Q155), W155 (= W157), D166 (= D168), Y263 (= Y264)
2glxA Crystal structure analysis of bacterial 1,5-af reductase (see paper)
38% identity, 43% coverage: 7:137/307 of query aligns to 4:140/332 of 2glxA
- active site: K93 (= K90)
- binding acetate ion: K93 (= K90)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G7 (= G10), A8 (≠ I11), S9 (≠ G12), T10 (≠ K13), I11 (= I14), S32 (≠ A32), T33 (≠ A33), R37 (= R37), S69 (≠ C66), T70 (= T67), N72 (≠ P69), H75 (≠ R72), E92 (= E89), K93 (= K90), H121 (= H118)
Sites not aligning to the query:
Q2I8V6 1,5-anhydro-D-fructose reductase; Anhydrofructose reductase; 1,5-anhydro-D-fructose reductase (1,5-anhydro-D-mannitol-forming); EC 1.1.1.292 from Ensifer adhaerens (Sinorhizobium morelense) (see paper)
38% identity, 43% coverage: 7:137/307 of query aligns to 5:141/333 of Q2I8V6
- ASTI 9:12 (≠ IGKI 11:14) binding
- S10 (≠ G12) mutation to G: Almost no effect.
- A13 (= A15) mutation to G: Can use NAD as cosubstrate as well as NADP.
- S33 (≠ A32) mutation to D: No activity.
- ST 33:34 (≠ AA 32:33) binding
- R38 (= R37) binding
- TTNELH 71:76 (≠ TPPEGR 67:72) binding
- EK 93:94 (= EK 89:90) binding
- K94 (= K90) mutation to G: Less than 1% remaining activity.
- N120 (≠ T116) binding
Sites not aligning to the query:
- 162:163 binding
- 176 D→A: Less than 1% remaining activity.
- 180 H→A: Less than 2% remaining activity.
- 206 G→I: No effect.
- 283 binding
1evjA Crystal structure of glucose-fructose oxidoreductase (gfor) delta1-22 s64d (see paper)
27% identity, 68% coverage: 3:212/307 of query aligns to 2:234/340 of 1evjA
- active site: K100 (= K90), Y188 (≠ N172)
- binding nicotinamide-adenine-dinucleotide: G9 (= G10), L10 (≠ I11), G11 (= G12), K12 (= K13), Y13 (≠ I14), D35 (≠ E45), L77 (≠ T67), P78 (= P68), N79 (≠ P69), H82 (≠ R72), E99 (= E89), K100 (= K90), R128 (≠ H118), W170 (= W157), R171 (≠ I158), Y188 (≠ N172)
Sites not aligning to the query:
1h6dA Oxidized precursor form of glucose-fructose oxidoreductase from zymomonas mobilis complexed with glycerol (see paper)
29% identity, 68% coverage: 3:212/307 of query aligns to 33:265/383 of 1h6dA
- active site: K131 (= K90), Y219 (≠ N172)
- binding glycerol: K131 (= K90), R202 (≠ I158), D215 (= D168), Y219 (≠ N172)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G40 (= G10), L41 (≠ I11), G42 (= G12), K43 (= K13), Y44 (≠ I14), S66 (= S36), G67 (≠ R37), K71 (vs. gap), Y89 (vs. gap), I107 (≠ C66), L108 (≠ T67), P109 (= P68), N110 (≠ P69), H113 (≠ R72), E130 (= E89), K131 (= K90), R159 (≠ H118), A198 (≠ G154), W201 (= W157), R202 (≠ I158), Y219 (≠ N172)
Sites not aligning to the query:
1rydA Crystal structure of glucose-fructose oxidoreductase from zymomonas mobilis
29% identity, 68% coverage: 3:212/307 of query aligns to 31:263/381 of 1rydA
- active site: K129 (= K90), Y217 (≠ N172)
- binding alpha-D-glucopyranose: Y236 (≠ A190), I254 (≠ A203), Q256 (≠ S205)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: L39 (≠ I11), G40 (= G12), K41 (= K13), Y42 (≠ I14), S64 (= S36), G65 (≠ R37), K69 (vs. gap), Y87 (vs. gap), L106 (≠ T67), P107 (= P68), N108 (≠ P69), L110 (≠ G71), H111 (≠ R72), E128 (= E89), K129 (= K90), R157 (≠ H118), A196 (≠ G154), W199 (= W157), R200 (≠ I158), Y217 (≠ N172)
Sites not aligning to the query:
4koaA Crystal structure analysis of 1,5-anhydro-d-fructose reductase from sinorhizobium meliloti (see paper)
34% identity, 44% coverage: 4:137/307 of query aligns to 2:141/333 of 4koaA
- active site: K94 (= K90)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G10), A9 (≠ I11), S10 (≠ G12), T11 (≠ K13), I12 (= I14), S33 (≠ A32), S34 (≠ A33), R38 (= R37), T71 (= T67), N73 (≠ P69), H76 (≠ R72), K94 (= K90)
Sites not aligning to the query:
3m2tA The crystal structure of dehydrogenase from chromobacterium violaceum
32% identity, 35% coverage: 4:111/307 of query aligns to 4:118/342 of 3m2tA
- binding nicotinamide-adenine-dinucleotide: G10 (= G10), G12 (= G12), A13 (≠ K13), Q14 (≠ I14), D36 (= D28), S37 (≠ F29), R41 (≠ A33), A73 (≠ C66), G74 (≠ T67), L78 (≠ G71), E96 (= E89), K97 (= K90)
Sites not aligning to the query:
7xr9A Crystal structure of dgpa with glucose (see paper)
30% identity, 36% coverage: 15:125/307 of query aligns to 16:126/344 of 7xr9A
Sites not aligning to the query:
4nheB The crystal structure of oxidoreductase (gfo/idh/moca family) from streptococcus pneumoniae tigr4 in complex with NADP
25% identity, 44% coverage: 4:137/307 of query aligns to 3:141/326 of 4nheB
- active site: K94 (= K90)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: T10 (≠ I11), I13 (= I14), S34 (= S36), R35 (= R37), T39 (vs. gap), A70 (≠ C66), S71 (≠ T67), P72 (= P68), N73 (≠ P69), H76 (≠ R72), E93 (= E89), K94 (= K90), R122 (≠ H118)
Sites not aligning to the query:
7d5nA Crystal structure of inositol dehydrogenase homolog complexed with nadh and myo-inositol from azotobacter vinelandii
25% identity, 58% coverage: 5:183/307 of query aligns to 23:210/379 of 7d5nA
- binding 1,4-dihydronicotinamide adenine dinucleotide: Q23 (≠ K5), I24 (≠ L6), D46 (= D28), I47 (≠ F29), T91 (= T67), P92 (= P68), N93 (≠ P69), H96 (≠ R72), E113 (= E89), K114 (= K90), W185 (= W151), R186 (≠ H152), H199 (≠ N172)
Sites not aligning to the query:
7d5nB Crystal structure of inositol dehydrogenase homolog complexed with nadh and myo-inositol from azotobacter vinelandii
26% identity, 58% coverage: 5:183/307 of query aligns to 23:219/389 of 7d5nB
- binding 1,2,3,4,5,6-hexahydroxy-cyclohexane: K114 (= K90), Y143 (≠ S119), R190 (vs. gap), D204 (= D168), H208 (≠ N172)
- binding 1,4-dihydronicotinamide adenine dinucleotide: Q23 (≠ K5), I24 (≠ L6), D46 (= D28), I47 (≠ F29), T91 (= T67), P92 (= P68), N93 (≠ P69), H96 (≠ R72), E113 (= E89), K114 (= K90), W189 (= W157), R190 (vs. gap), H208 (≠ N172)
Sites not aligning to the query:
7d5mA Crystal structure of inositol dehydrogenase homolog complexed with NAD+ from azotobacter vinelandii
26% identity, 58% coverage: 5:183/307 of query aligns to 24:220/389 of 7d5mA
- binding nicotinamide-adenine-dinucleotide: Q24 (≠ K5), I25 (≠ L6), D47 (= D28), I48 (≠ F29), T92 (= T67), P93 (= P68), N94 (≠ P69), H97 (≠ R72), E114 (= E89), K115 (= K90), W190 (= W157), R191 (vs. gap), H209 (≠ N172)
Sites not aligning to the query:
7xreC Crystal structure of dgpa (see paper)
33% identity, 23% coverage: 54:125/307 of query aligns to 65:136/363 of 7xreC
Sites not aligning to the query:
3q2kC Crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca (see paper)
31% identity, 38% coverage: 3:120/307 of query aligns to 7:130/347 of 3q2kC
- active site: K100 (= K90)
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: R17 (≠ K13), K100 (= K90)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G16 (= G12), R17 (≠ K13), I18 (= I14), D40 (≠ S36), T41 (≠ R37), A76 (≠ C66), T77 (= T67), S79 (≠ P69), H82 (≠ R72), Q85 (= Q75), E99 (= E89), K100 (= K90), Q128 (≠ H118)
Sites not aligning to the query:
- active site: 188
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: 159, 160, 161, 165, 184, 185, 188, 243, 244
- binding 1,4-dihydronicotinamide adenine dinucleotide: 171, 172
3q2kK Crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca (see paper)
31% identity, 38% coverage: 3:120/307 of query aligns to 2:125/322 of 3q2kK
- active site: K95 (= K90)
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: R12 (≠ K13), K95 (= K90)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G9 (= G10), G11 (= G12), R12 (≠ K13), I13 (= I14), D35 (≠ A33), T36 (= T34), T72 (= T67), P73 (= P68), S74 (≠ P69), L76 (≠ G71), H77 (≠ R72), E94 (= E89), K95 (= K90), Q123 (≠ H118)
Sites not aligning to the query:
- active site: 183
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: 155, 156, 160, 179, 180, 183, 239
- binding 1,4-dihydronicotinamide adenine dinucleotide: 166, 167, 183
3dtyA Crystal structure of an oxidoreductase from pseudomonas syringae
28% identity, 44% coverage: 49:182/307 of query aligns to 68:196/374 of 3dtyA
3q2iA Crystal structure of the wlba dehydrognase from chromobactrium violaceum in complex with nadh and udp-glcnaca at 1.50 a resolution (see paper)
27% identity, 55% coverage: 3:170/307 of query aligns to 11:184/345 of 3q2iA
- active site: K104 (= K90)
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: K104 (= K90), N133 (≠ S119), T164 (≠ H152), R165 (≠ P153), Y169 (≠ W157)
- binding 1,4-dihydronicotinamide adenine dinucleotide: C19 (≠ I11), G20 (= G12), R21 (≠ K13), I22 (= I14), D44 (= D28), I45 (≠ F29), T81 (= T67), P82 (= P68), S83 (≠ P69), H86 (≠ R72), E103 (= E89), K104 (= K90), Q132 (≠ H118), W175 (≠ G163), R176 (≠ F164)
Sites not aligning to the query:
- active site: 192
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: 188, 189, 192, 247, 248
- binding 1,4-dihydronicotinamide adenine dinucleotide: 192
1zh8A Crystal structure of oxidoreductase (tm0312) from thermotoga maritima at 2.50 a resolution
28% identity, 42% coverage: 3:130/307 of query aligns to 3:147/325 of 1zh8A
- active site: K98 (= K90)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G10), C11 (≠ I11), G12 (= G12), I13 (≠ K13), A14 (≠ I14), S37 (= S36), R38 (= R37), T39 (vs. gap), H42 (vs. gap), T74 (≠ C66), L75 (≠ T67), P76 (= P68), L79 (≠ G71), E97 (= E89), K98 (= K90), N126 (vs. gap)
Sites not aligning to the query:
Query Sequence
>Ga0059261_1621 FitnessBrowser__Korea:Ga0059261_1621
VDRIKLGLVGIGKIARDQHLPAIAASVDFELAATASRHGRVDGVEGHGSIVELIAARPEI
DALSLCTPPEGRFEQAMAAIAAGKHVMLEKPPAATVSEARTLEQAAYAAGVSLYATWHSR
EAGEVDAARDWLAARRIDAVRIRWMEDIRQWHPGQDWILAAGGFGVFDPGINALSIATRI
LPQPLTVLAATMDIPANRACPIAASVRFRTGSAEVDAKFDFLQTGEQTWQIEVETDAGLL
RLTEGGGRLERPGQPSLSGPDREYPRLYRAFAELIRSGQSDVDLQPIQLVADAFLVAERR
IVDPFQF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory