Comparing Ga0059261_1644 FitnessBrowser__Korea:Ga0059261_1644 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8fdbB Crystal structure of nagb-ii phosphosugar isomerase from shewanella denitrificans os217 in complex with glucitolamine-6-phosphate at 3.06 a resolution. (see paper)
43% identity, 97% coverage: 11:347/347 of query aligns to 4:333/333 of 8fdbB
8fdbA Crystal structure of nagb-ii phosphosugar isomerase from shewanella denitrificans os217 in complex with glucitolamine-6-phosphate at 3.06 a resolution. (see paper)
43% identity, 97% coverage: 11:347/347 of query aligns to 3:332/332 of 8fdbA
8eymA Crystal structure of nagb-ii phosphosugar isomerase from shewanella denitrificans os217 in complex with glucitolamine-6-phosphate and n- acetylglucosamine-6-phosphate at 2.31 a resolution (see paper)
42% identity, 94% coverage: 11:335/347 of query aligns to 2:319/319 of 8eymA
1morA Isomerase domain of glucosamine 6-phosphate synthase complexed with glucose 6-phosphate (see paper)
28% identity, 84% coverage: 51:342/347 of query aligns to 55:361/366 of 1morA
1moqA Isomerase domain of glucosamine 6-phosphate synthase complexed with glucosamine 6-phosphate (see paper)
28% identity, 84% coverage: 51:342/347 of query aligns to 55:361/366 of 1moqA
4amvA E.Coli glucosamine-6p synthase in complex with fructose-6p (see paper)
28% identity, 84% coverage: 51:342/347 of query aligns to 297:603/608 of 4amvA
Sites not aligning to the query:
1jxaA Glucosamine 6-phosphate synthase with glucose 6-phosphate (see paper)
28% identity, 84% coverage: 51:342/347 of query aligns to 297:603/608 of 1jxaA
Sites not aligning to the query:
1mosA Isomerase domain of glucosamine 6-phosphate synthase complexed with 2- amino-2-deoxyglucitol 6-phosphate (see paper)
28% identity, 84% coverage: 51:342/347 of query aligns to 56:362/367 of 1mosA
2j6hA E. Coli glucosamine-6-p synthase in complex with glucose-6p and 5-oxo- l-norleucine (see paper)
28% identity, 84% coverage: 51:342/347 of query aligns to 297:603/608 of 2j6hA
Sites not aligning to the query:
7dnrA Crystal structure of zn-bound sis domain of glucosamine-6-p synthase from e. Coli
28% identity, 83% coverage: 51:337/347 of query aligns to 55:356/357 of 7dnrA
2zj4A Isomerase domain of human glucose:fructose-6-phosphate amidotransferase (see paper)
26% identity, 84% coverage: 50:342/347 of query aligns to 54:360/365 of 2zj4A
2zj3A Isomerase domain of human glucose:fructose-6-phosphate amidotransferase (see paper)
26% identity, 84% coverage: 50:342/347 of query aligns to 54:360/365 of 2zj3A
6r4eA Crystal structure of human gfat-1 in complex with glucose-6-phosphate and l-glu (see paper)
26% identity, 84% coverage: 50:342/347 of query aligns to 352:658/663 of 6r4eA
Sites not aligning to the query:
6svmA Crystal structure of human gfat-1 in complex with glucose-6-phosphate, l-glu, and udp-galnac (see paper)
26% identity, 84% coverage: 50:342/347 of query aligns to 349:655/660 of 6svmA
Sites not aligning to the query:
Q06210 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1; D-fructose-6-phosphate amidotransferase 1; Glutamine:fructose-6-phosphate amidotransferase 1; GFAT 1; GFAT1; Hexosephosphate aminotransferase 1; EC 2.6.1.16 from Homo sapiens (Human) (see paper)
26% identity, 84% coverage: 50:342/347 of query aligns to 388:694/699 of Q06210
6r4gA Crystal structure of human gfat-1 in complex with udp-glcnac (see paper)
26% identity, 84% coverage: 50:340/347 of query aligns to 348:652/652 of 6r4gA
Sites not aligning to the query:
2v4mA The isomerase domain of human glutamine-fructose-6-phosphate transaminase 1 (gfpt1) in complex with fructose 6-phosphate
26% identity, 82% coverage: 50:335/347 of query aligns to 53:352/352 of 2v4mA
2pocB The crystal structure of isomerase domain of glucosamine-6-phosphate synthase from candida albicans (see paper)
26% identity, 80% coverage: 57:335/347 of query aligns to 56:352/352 of 2pocB
Sites not aligning to the query:
P14742 Glutamine--fructose-6-phosphate aminotransferase [isomerizing]; GFAT; D-fructose-6-phosphate amidotransferase; Hexosephosphate aminotransferase; EC 2.6.1.16 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
24% identity, 86% coverage: 43:342/347 of query aligns to 394:712/717 of P14742
Sites not aligning to the query:
2puwB The crystal structure of isomerase domain of glucosamine-6-phosphate synthase from candida albicans (see paper)
24% identity, 80% coverage: 57:335/347 of query aligns to 56:331/331 of 2puwB
Sites not aligning to the query:
>Ga0059261_1644 FitnessBrowser__Korea:Ga0059261_1644
MVPNAAGASLGTLMEREAAEAGAAVSRMLAANRDAIERVAARLRASPPAVVVTCARGSSD
HAATYAKYLIETLTGVPTASAALSVASLYDAPVAPGNGLCLAISQSGKSPDLLATVEHQR
KAGAFVVAMVNAEDSPLAALADIVIPLKAGPERSVAATKSYICSLAAIAALVAAWAQDEA
LETAVADLPAQLERAFALDWSAAVTALTGASGLFVLGRGYGYGIAQEAALKFKETCALHA
ESFSAAEVRHGPMAIVGEAFHVLAFASSDRAGESVRETVAEFRSRGAEVLLADPAARQAG
LPAIAAHPAIEPILIVQSFYKMANALALARGCDPDSPPHLNKVTETL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory