Comparing Ga0059261_1646 FitnessBrowser__Korea:Ga0059261_1646 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2hwgA Structure of phosphorylated enzyme i of the phosphoenolpyruvate:sugar phosphotransferase system (see paper)
37% identity, 67% coverage: 273:828/830 of query aligns to 1:571/572 of 2hwgA
P08839 Phosphoenolpyruvate-protein phosphotransferase; Phosphotransferase system, enzyme I; EC 2.7.3.9 from Escherichia coli (strain K12) (see 2 papers)
37% identity, 67% coverage: 273:828/830 of query aligns to 2:572/575 of P08839
P23533 Phosphoenolpyruvate-protein phosphotransferase; Phosphotransferase system, enzyme I; EC 2.7.3.9 from Staphylococcus carnosus (strain TM300) (see paper)
34% identity, 67% coverage: 272:830/830 of query aligns to 4:573/573 of P23533
2wqdA Crystal structure of enzyme i of the phosphoenolpyruvate:sugar phosphotransferase system in the dephosphorylated state (see paper)
33% identity, 67% coverage: 273:825/830 of query aligns to 4:569/570 of 2wqdA
2xz7A Crystal structure of the phosphoenolpyruvate-binding domain of enzyme i in complex with phosphoenolpyruvate from the thermoanaerobacter tengcongensis pep-sugar phosphotransferase system (pts) (see paper)
45% identity, 36% coverage: 524:823/830 of query aligns to 14:318/324 of 2xz7A
2xz9A Crystal structure from the phosphoenolpyruvate-binding domain of enzyme i in complex with pyruvate from the thermoanaerobacter tengcongensis pep-sugar phosphotransferase system (pts) (see paper)
45% identity, 36% coverage: 524:823/830 of query aligns to 7:311/317 of 2xz9A
5lu4A C4-type pyruvate phosphate dikinase: conformational intermediate of central domain in the swiveling mechanism (see paper)
30% identity, 45% coverage: 418:791/830 of query aligns to 425:844/850 of 5lu4A
Sites not aligning to the query:
5jvjB C4-type pyruvate phosphate dikinase: different conformational states of the nucleotide binding domain in the dimer (see paper)
29% identity, 45% coverage: 418:791/830 of query aligns to 352:789/797 of 5jvjB
Sites not aligning to the query:
5jvlA C4-type pyruvate phospate dikinase: nucleotide binding domain with bound atp analogue (see paper)
28% identity, 45% coverage: 418:791/830 of query aligns to 425:866/874 of 5jvlA
Sites not aligning to the query:
Q39735 Pyruvate, phosphate dikinase, chloroplastic; Cold-sensitive pyruvate, orthophosphate dikinase; Pyruvate, orthophosphate dikinase; EC 2.7.9.1 from Flaveria bidentis (Coastal plain yellowtops) (Ethulia bidentis) (see 2 papers)
28% identity, 45% coverage: 418:791/830 of query aligns to 504:945/953 of Q39735
Sites not aligning to the query:
O23404 Pyruvate, phosphate dikinase 1, chloroplastic; Pyruvate, orthophosphate dikinase 1; EC 2.7.9.1 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
29% identity, 46% coverage: 419:800/830 of query aligns to 515:963/963 of O23404
P22983 Pyruvate, phosphate dikinase; Pyruvate, orthophosphate dikinase; EC 2.7.9.1 from Clostridium symbiosum (Bacteroides symbiosus) (see 4 papers)
27% identity, 45% coverage: 419:788/830 of query aligns to 425:860/874 of P22983
Sites not aligning to the query:
1kc7A Pyruvate phosphate dikinase with bound mg-phosphonopyruvate (see paper)
27% identity, 45% coverage: 419:788/830 of query aligns to 424:859/872 of 1kc7A
Sites not aligning to the query:
5jvlB C4-type pyruvate phospate dikinase: nucleotide binding domain with bound atp analogue (see paper)
30% identity, 32% coverage: 530:791/830 of query aligns to 180:512/520 of 5jvlB
Sites not aligning to the query:
P11155 Pyruvate, phosphate dikinase 1, chloroplastic; Pyruvate, orthophosphate dikinase 1; EC 2.7.9.1 from Zea mays (Maize) (see 7 papers)
28% identity, 47% coverage: 403:791/830 of query aligns to 482:939/947 of P11155
Sites not aligning to the query:
1vbgA Pyruvate phosphate dikinase from maize (see paper)
28% identity, 47% coverage: 403:791/830 of query aligns to 409:866/874 of 1vbgA
Sites not aligning to the query:
1vbhA Pyruvate phosphate dikinase with bound mg-pep from maize (see paper)
29% identity, 32% coverage: 530:791/830 of query aligns to 522:854/862 of 1vbhA
Sites not aligning to the query:
Q02KR1 Phosphoenolpyruvate synthase; PEP synthase; Pyruvate, water dikinase; EC 2.7.9.2 from Pseudomonas aeruginosa (strain UCBPP-PA14) (see paper)
28% identity, 48% coverage: 409:806/830 of query aligns to 378:791/791 of Q02KR1
P09323 PTS system N-acetylglucosamine-specific EIICBA component; EIICBA-Nag; EII-Nag; EC 2.7.1.193 from Escherichia coli (strain K12) (see paper)
40% identity, 15% coverage: 5:130/830 of query aligns to 501:626/648 of P09323
Sites not aligning to the query:
P69783 PTS system glucose-specific EIIA component; EIIA-Glc; EIII-Glc; Glucose-specific phosphotransferase enzyme IIA component from Escherichia coli (strain K12) (see 6 papers)
41% identity, 15% coverage: 5:127/830 of query aligns to 23:145/169 of P69783
Sites not aligning to the query:
>Ga0059261_1646 FitnessBrowser__Korea:Ga0059261_1646
MALIITSPLRGWAAPLDSVPDPVFAQRMMGDGVAIQPLADTVCAPFDGEVVTLHEAGHAV
SLRSDEGAEVLIHIGLDTVGLKGRGFTPLVAPGATVARGDPLIRFDMDAVALGATSLITP
VIVTNAEAFTITRRTMGRAIGAHEELMALAPARTQPRRWSDDGTVIEERVTLILPHGIHA
RPAARLGECARQFEAEIHLLHGDKRGDARSTVGLLALGTRLGDELVVQARGSDAEAALAA
IVALLGSDMGEGAPAHAPAIAVPAAPVLQPGQIGGVIASPGLAMGPAARLRQTAIAVERE
GKGVDAERTALDAARTEVRVRIGARADAAGGSVAAVMRAHLALLDDPELAAGAETRIAAG
NSAGYAWRGAVHDQIAALKATGNAHLIERTDDLVDIERQVLGVLTGIPAEADAIAAGAIL
VADDLLPSQLVSIAASKPAGICLVRGGPTSHVAILCAGMGLPALVAMGDAIEAIEDGTAL
LLDAEAGHVTPDPSQADADAFAARLAKREARRDAARAAAGNACQTADGVRIELFANLGTV
EDAKAAAAQGAEGSGLVRSEFLFLDREDAPSEDEQHAAYQGIADALPGKPVIVRLLDVGG
DKPAAYIPFDAEENPALGLRGIRVGLAHRDLLETQIRAILRVQPVGQCRIMLPMVASVSE
IRAVREVVERLRGEMGIETPIEVGVMVETPAAAITADLLAAEADFLSIGTNDLTQYVLAM
DRGNPAVASGVDAMHPAVLRMIAETCRRATAKGRWVGVCGGLASDPAAVPILIGLGATEL
STVPGFVPEAKAIVRSVTLADARDHAERALHCSSAAEVRALARAFEEKNA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory