Comparing Ga0059261_1675 FitnessBrowser__Korea:Ga0059261_1675 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7rsfA Acetylornithine deacetylase from escherichia coli
35% identity, 91% coverage: 15:372/395 of query aligns to 6:358/380 of 7rsfA
7uoiA Crystallographic structure of dape from enterococcus faecium
28% identity, 95% coverage: 15:389/395 of query aligns to 11:373/383 of 7uoiA
5vo3A Crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) (see paper)
29% identity, 83% coverage: 62:387/395 of query aligns to 54:374/380 of 5vo3A
P44514 Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 3 papers)
29% identity, 83% coverage: 62:387/395 of query aligns to 50:370/377 of P44514
Q8P8J5 N-acetyl-L-citrulline deacetylase; ACDase; Acetylcitrulline deacetylase; EC 3.5.1.- from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) (see paper)
28% identity, 95% coverage: 12:387/395 of query aligns to 6:361/366 of Q8P8J5
2f7vA Structure of acetylcitrulline deacetylase complexed with one co (see paper)
28% identity, 95% coverage: 12:387/395 of query aligns to 7:356/360 of 2f7vA
7lgpB Dape enzyme from shigella flexneri
31% identity, 52% coverage: 62:267/395 of query aligns to 52:259/377 of 7lgpB
4h2kA Crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae (see paper)
44% identity, 29% coverage: 62:174/395 of query aligns to 52:168/258 of 4h2kA
Sites not aligning to the query:
3pfoA Crystal structure of a putative acetylornithine deacetylase (rpa2325) from rhodopseudomonas palustris cga009 at 1.90 a resolution
29% identity, 56% coverage: 43:262/395 of query aligns to 66:288/426 of 3pfoA
Sites not aligning to the query:
7t1qA Crystal structure of the succinyl-diaminopimelate desuccinylase (dape) from acinetobacter baumannii in complex with succinic acid
31% identity, 52% coverage: 62:267/395 of query aligns to 50:258/377 of 7t1qA
Sites not aligning to the query:
4o23A Crystal structure of mono-zinc form of succinyl diaminopimelate desuccinylase from neisseria meningitidis mc58 (see paper)
28% identity, 64% coverage: 14:267/395 of query aligns to 5:258/376 of 4o23A
4pqaA Crystal structure of succinyl-diaminopimelate desuccinylase from neisseria meningitidis mc58 in complex with the inhibitor captopril (see paper)
28% identity, 64% coverage: 14:267/395 of query aligns to 5:258/375 of 4pqaA
Sites not aligning to the query:
3rzaA Crystal structure of a tripeptidase (sav1512) from staphylococcus aureus subsp. Aureus mu50 at 2.10 a resolution
25% identity, 76% coverage: 76:377/395 of query aligns to 74:356/373 of 3rzaA
Sites not aligning to the query:
P37111 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Sus scrofa (Pig) (see paper)
28% identity, 53% coverage: 74:284/395 of query aligns to 75:292/407 of P37111
Sites not aligning to the query:
5xoyA Crystal structure of lysk from thermus thermophilus in complex with lysine (see paper)
28% identity, 95% coverage: 15:390/395 of query aligns to 4:340/341 of 5xoyA
4op4B Crystal structure of the catalytic domain of dape protein from v.Cholerea in the zn bound form (see paper)
35% identity, 29% coverage: 61:174/395 of query aligns to 49:166/265 of 4op4B
Sites not aligning to the query:
Q03154 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Homo sapiens (Human) (see 6 papers)
25% identity, 54% coverage: 72:284/395 of query aligns to 73:293/408 of Q03154
Sites not aligning to the query:
Q8C165 N-fatty-acyl-amino acid synthase/hydrolase PM20D1; Peptidase M20 domain-containing protein 1; PM20D1; EC 3.5.1.114; EC 3.5.1.14 from Mus musculus (Mouse) (see paper)
30% identity, 41% coverage: 4:163/395 of query aligns to 34:212/503 of Q8C165
Sites not aligning to the query:
3dljA Crystal structure of human carnosine dipeptidase 1
35% identity, 25% coverage: 63:160/395 of query aligns to 83:181/471 of 3dljA
Sites not aligning to the query:
Q96KN2 Beta-Ala-His dipeptidase; CNDP dipeptidase 1; Carnosine dipeptidase 1; Glutamate carboxypeptidase-like protein 2; Serum carnosinase; EC 3.4.13.20 from Homo sapiens (Human) (see 4 papers)
35% identity, 25% coverage: 63:160/395 of query aligns to 114:212/507 of Q96KN2
Sites not aligning to the query:
>Ga0059261_1675 FitnessBrowser__Korea:Ga0059261_1675
MAARSADRRPSAATVEILRTLVGFPTVSRDSNLDLIHWVRDYLASHGVASVLTSGKDPGK
ANLFATIGSGEGGIVLSGHSDVVPVDGQDWHSNPFVLEERDGLLFGRGTCDMKGFIAACL
AKVPMLASANLNEPVHLAISFDEEIGCKGAGHMIEELVARGLRPRGCVVGEPTSMEPVIG
HKTGSAYGCAVHGLEAHSSLAPYGVNAIFYAARLIARIEAIAARLRAEERRHPGYSVPFS
TLSAGVIEGGQASNIVPALCRFRFDIRTLPWTDPDAIIAELQTYIDHELLPEMRAVHAGA
RIEITMNGRVPGFAIDADAPLTRHVQRLAGSNAEPGFVAFGSEAGLFQARGVPTILCGPG
SIEQAHKPDEFVALDQLARCEDFLDRLAQTPFEPA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory