Comparing Ga0059261_1678 FitnessBrowser__Korea:Ga0059261_1678 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8skyB Crystal structure of yisk from bacillus subtilis in complex with oxalate (see paper)
31% identity, 95% coverage: 14:321/325 of query aligns to 14:301/303 of 8skyB
8sutA Crystal structure of yisk from bacillus subtilis in complex with reaction product 4-hydroxy-2-oxoglutaric acid (see paper)
31% identity, 95% coverage: 14:321/325 of query aligns to 15:302/303 of 8sutA
6iymA Fumarylacetoacetate hydrolase (eafah) from psychrophilic exiguobacterium antarcticum (see paper)
38% identity, 54% coverage: 150:323/325 of query aligns to 108:277/277 of 6iymA
8gstC Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Pyruvate bound-form) (see paper)
36% identity, 58% coverage: 135:324/325 of query aligns to 94:282/290 of 8gstC
Sites not aligning to the query:
8gsrA Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Apo-form) (see paper)
36% identity, 58% coverage: 135:324/325 of query aligns to 94:282/290 of 8gsrA
3r6oA Crystal structure of a probable 2-hydroxyhepta-2,4-diene-1, 7- dioateisomerase from mycobacterium abscessus (see paper)
35% identity, 58% coverage: 136:324/325 of query aligns to 77:264/265 of 3r6oA
4dbhA Crystal structure of cg1458 with inhibitor (see paper)
34% identity, 62% coverage: 120:320/325 of query aligns to 79:266/269 of 4dbhA
Sites not aligning to the query:
6v77B Crystal structure of a putative hpce protein from mycobacterium smegmatis
33% identity, 57% coverage: 134:319/325 of query aligns to 92:274/279 of 6v77B
3qdfA Crystal structure of 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase from mycobacterium marinum (see paper)
34% identity, 57% coverage: 136:320/325 of query aligns to 76:247/252 of 3qdfA
1gttA Crystal structure of hpce (see paper)
31% identity, 47% coverage: 134:287/325 of query aligns to 237:387/421 of 1gttA
6j5xB Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
30% identity, 49% coverage: 162:319/325 of query aligns to 119:275/280 of 6j5xB
Sites not aligning to the query:
6j5xA Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
30% identity, 49% coverage: 162:319/325 of query aligns to 119:275/280 of 6j5xA
6j5yA Crystal structure of fumarylpyruvate hydrolase from pseudomonas aeruginosa in complex with mn2+ and pyruvate (see paper)
29% identity, 52% coverage: 153:320/325 of query aligns to 70:230/233 of 6j5yA
Sites not aligning to the query:
6sbiA X-ray structure of murine fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate (see paper)
28% identity, 52% coverage: 151:320/325 of query aligns to 51:213/216 of 6sbiA
Sites not aligning to the query:
Q6P587 Acylpyruvase FAHD1, mitochondrial; Fumarylacetoacetate hydrolase domain-containing protein 1; FAH domain-containing protein 1; Oxaloacetate decarboxylase; OAA decarboxylase; YisK-like protein; EC 3.7.1.5; EC 4.1.1.112 from Homo sapiens (Human) (see 3 papers)
30% identity, 42% coverage: 151:287/325 of query aligns to 57:192/224 of Q6P587
Sites not aligning to the query:
6fogA X-ray structure of homo sapiens fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate at 1.94a resolution. (see paper)
30% identity, 42% coverage: 151:287/325 of query aligns to 52:187/218 of 6fogA
Sites not aligning to the query:
2q1dX 2-keto-3-deoxy-d-arabinonate dehydratase complexed with magnesium and 2,5-dioxopentanoate (see paper)
27% identity, 66% coverage: 113:325/325 of query aligns to 74:281/281 of 2q1dX
6jvwB Crystal structure of maleylpyruvate hydrolase from sphingobium sp. Syk-6 in complex with manganese (ii) ion and pyruvate (see paper)
27% identity, 88% coverage: 1:287/325 of query aligns to 1:233/264 of 6jvwB
3bqbX Hexagonal kristal form of 2-keto-3-deoxyarabinonate dehydratase (see paper)
28% identity, 58% coverage: 138:325/325 of query aligns to 116:291/291 of 3bqbX
2q1cX 2-keto-3-deoxy-d-arabinonate dehydratase complexed with calcium and 2- oxobutyrate (see paper)
28% identity, 58% coverage: 138:325/325 of query aligns to 116:291/291 of 2q1cX
Sites not aligning to the query:
>Ga0059261_1678 FitnessBrowser__Korea:Ga0059261_1678
MKLVTFDAGEGPRTGAIIGDGSIVDLAAAAPEAERGMLSTMLALIEGGEPALDAAREIVA
RSRGDHGYDPAYVRYLPPLPVPNSIRDFANFELHCLQALEASMRMRAASQPDPEAAYAGF
KASGAYDLPASWYQRPYYFKGNRMTCSGHDSVIQWPRFSGTMDYELEFAAVIGTRGADIA
EADADAHIFGYMIYNDFSARDEQVRDQQFRMGPSKGKDFDTGNAMGPWIVTRDELPDVSN
LAMTSRINGEVQGRSNSSGMQFSFAQCIAFVSRDETLYPGDVFGSGTAGNGCGFETGRYL
EPGDVIELEVEGIGVLRNRIGERRS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory