Comparing Ga0059261_1693 FitnessBrowser__Korea:Ga0059261_1693 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
5ti1H Crystal structure of fumarylacetoacetate hydrolase from burkholderia xenovorans lb400
55% identity, 98% coverage: 5:413/419 of query aligns to 14:430/430 of 5ti1H
P16930 Fumarylacetoacetase; FAA; Beta-diketonase; Fumarylacetoacetate hydrolase; EC 3.7.1.2 from Homo sapiens (Human) (see 14 papers)
49% identity, 95% coverage: 13:412/419 of query aligns to 7:416/419 of P16930
Sites not aligning to the query:
P35505 Fumarylacetoacetase; FAA; Beta-diketonase; Fumarylacetoacetate hydrolase; EC 3.7.1.2 from Mus musculus (Mouse) (see 3 papers)
49% identity, 95% coverage: 13:412/419 of query aligns to 7:416/419 of P35505
2hzyA Mouse fumarylacetoacetate hydrolase complexes with a transition-state mimic of the complete substrate (see paper)
49% identity, 95% coverage: 13:412/419 of query aligns to 7:416/416 of 2hzyA
1qcoA Crystal structure of fumarylacetoacetate hydrolase complexed with fumarate and acetoacetate (see paper)
49% identity, 95% coverage: 13:412/419 of query aligns to 7:416/416 of 1qcoA
1hyoB Crystal structure of fumarylacetoacetate hydrolase complexed with 4- (hydroxymethylphosphinoyl)-3-oxo-butanoic acid (see paper)
49% identity, 95% coverage: 13:412/419 of query aligns to 9:418/419 of 1hyoB
6iymA Fumarylacetoacetate hydrolase (eafah) from psychrophilic exiguobacterium antarcticum (see paper)
38% identity, 21% coverage: 179:268/419 of query aligns to 103:191/277 of 6iymA
8skyB Crystal structure of yisk from bacillus subtilis in complex with oxalate (see paper)
26% identity, 39% coverage: 192:353/419 of query aligns to 142:273/303 of 8skyB
Sites not aligning to the query:
8sutA Crystal structure of yisk from bacillus subtilis in complex with reaction product 4-hydroxy-2-oxoglutaric acid (see paper)
26% identity, 39% coverage: 192:353/419 of query aligns to 143:274/303 of 8sutA
Sites not aligning to the query:
>Ga0059261_1693 FitnessBrowser__Korea:Ga0059261_1693
MSPLRSWVAAANAADTDFPLNNLPYGVFSDATRGPRCGVAIGDRILDMAALEAAGLLRLG
DVPLFAEPGWNTLMAQGPAVWGALRAQLIALLAEGAAERVAVEPHLVPMAGAQLHLPFRV
AGYTDFYASRQHAFNVGTMFRGAENALPPNWLHIPIGYNGRASSVVVSGTDVRRPWGQVK
GPEDAAPRFAPSARFDIELELGAIVGTGSSDPLTVAEADAMIFGYVLLNDWSARDIQAWE
YQPLGPFQGKATATTISPWIVTAAALEPFRAHGPAREKPLLPYLDEPGPMLYDIDLEVGL
TPEGGAESVISRTSYREMYYSAAQQLAHHSTAGCRMEVGDLLGTGTISGPDKGSFGSLLE
LSWGGKEPLTLAGGAQRSFVEDGDTLILRGQCRGDGYRIGFGDCSGTVIPAFEDPYRRS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory