SitesBLAST
Comparing Ga0059261_1776 FitnessBrowser__Korea:Ga0059261_1776 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 14 hits to proteins with known functional sites (download)
1xc3A Structure of a putative fructokinase from bacillus subtilis (see paper)
41% identity, 87% coverage: 18:308/335 of query aligns to 2:287/295 of 1xc3A
3lm9A Crystal structure of fructokinase with adp and fructose bound in the active site (see paper)
41% identity, 87% coverage: 18:308/335 of query aligns to 2:287/294 of 3lm9A
- binding adenosine-5'-diphosphate: G130 (= G151), T131 (= T152), G182 (= G204), P183 (= P205), E186 (≠ K208), A193 (= A215), G231 (= G253)
- binding beta-D-fructofuranose: G60 (= G81), D104 (= D125), I133 (= I154), E151 (= E172), E177 (= E199)
- binding zinc ion: H154 (= H175), C169 (= C191), H172 (= H194), C175 (= C197)
2yhwA High-resolution crystal structures of n-acetylmannosamine kinase: insights about substrate specificity, activity and inhibitor modelling. (see paper)
29% identity, 37% coverage: 21:145/335 of query aligns to 7:133/309 of 2yhwA
Sites not aligning to the query:
2yi1A Crystal structure of n-acetylmannosamine kinase in complex with n- acetyl mannosamine 6-phosphate and adp. (see paper)
29% identity, 37% coverage: 21:145/335 of query aligns to 7:133/308 of 2yi1A
- binding adenosine-5'-diphosphate: G11 (= G25), T13 (= T27), N14 (≠ K28), R16 (≠ L30)
- binding 2-acetamido-2-deoxy-6-O-phosphono-alpha-D-mannopyranose: G12 (= G26), G71 (≠ L85), G72 (≠ D86), R73 (≠ P87), S84 (≠ T98), T85 (≠ P99), L87 (vs. gap), N112 (≠ T124), D113 (= D125)
- binding calcium ion: N112 (≠ T124), N115 (= N127)
Sites not aligning to the query:
- binding adenosine-5'-diphosphate: 140, 189, 216, 261
- binding 2-acetamido-2-deoxy-6-O-phosphono-alpha-D-mannopyranose: 139, 140, 141, 142, 162, 165, 184
- binding calcium ion: 144, 161
- binding zinc ion: 165, 175, 177, 182
2yhyA Structure of n-acetylmannosamine kinase in complex with n- acetylmannosamine and adp (see paper)
29% identity, 37% coverage: 21:145/335 of query aligns to 7:133/308 of 2yhyA
Sites not aligning to the query:
Q9Y223 Bifunctional UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase; UDP-GlcNAc-2-epimerase/ManAc kinase; EC 3.2.1.183; EC 2.7.1.60 from Homo sapiens (Human) (see 18 papers)
29% identity, 39% coverage: 15:145/335 of query aligns to 405:537/722 of Q9Y223
- D413 (≠ E23) binding
- G416 (= G26) binding
- T417 (= T27) binding
- N418 (≠ K28) binding
- R420 (≠ L30) binding
- I472 (≠ P82) to T: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; corresponding to 50% of the wild-type activity; decreased N-acylmannosamine kinase activity; corresponding to less than 10% of wild-type activity
- G476 (≠ D86) binding ; binding
- R477 (≠ P87) binding ; binding
- T489 (≠ P99) binding ; binding
- N516 (≠ T124) binding ; binding
- D517 (= D125) active site; binding ; binding ; mutation D->A,N: Loss of N-acylmannosamine kinase activity. Decreased affinity for N-acyl-D-mannosamine. No effect on structure.
- N519 (= N127) to S: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; decreased N-acylmannosamine kinase activity; dbSNP:rs1554658910; mutation to S: Decreased N-acylmannosamine kinase activity.
- A524 (≠ G132) to V: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; corresponding to less than 10% of wild-type activity; decreased N-acylmannosamine kinase activity; impaired homohexamers formation; dbSNP:rs764698870
- F528 (= F136) to C: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; retains 70% of wild-type activity; decreased N-acylmannosamine kinase activity; dbSNP:rs986773986; mutation to C: Decreased N-acylmannosamine kinase activity.
Sites not aligning to the query:
- 13 C → S: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; corresponding to 20% of wild-type activity; no effect on N-acylmannosamine kinase activity; dbSNP:rs1209266607
- 19 binding
- 23 binding
- 113 binding
- 132 H → Q: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; corresponding to less than 10% of wild-type activity; impaired homohexamers formation
- 176 D → V: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; corresponding to 20% of wild-type activity; no effect on N-acylmannosamine kinase activity; impaired homohexamers formation; dbSNP:rs139425890
- 177 R → C: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; corresponding to less than 20% of wild-type activity; no effect on N-acylmannosamine kinase activity; impaired homohexamers formation; dbSNP:rs539332585
- 200 I → F: in NM; uncertain significance; decreased UDP-N-acetylglucosamine 2-epimerase activity; retains 90% of wild-type activity; decreased N-acylmannosamine kinase activity; retains 75% of wild-type activity; dbSNP:rs369328625
- 206 G → S: in NM; moderate phenotype with unusual involvement of quadriceps; dbSNP:rs766266918
- 220 binding
- 253 binding
- 259 binding
- 263 R → L: in SIALURIA; strong reduction of feedback inhibition by CMP-Neu5Ac; dbSNP:rs121908623
- 266 R → Q: in SIALURIA; abolishes feedback inhibition by CMP-Neu5Ac; dbSNP:rs121908622; R → W: in sialuria; dbSNP:rs121908621
- 271 binding
- 280 binding
- 281 binding
- 282 binding
- 301 binding
- 302 binding
- 303 C → V: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; retains 80% of wild-type activity; decreased N-acylmannosamine kinase activity; corresponding to 60% of wild-type activity; requires 2 nucleotide substitutions; dbSNP:rs121908633
- 307 binding
- 321 binding
- 331 V → A: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; corresponding to 20% of wild-type activity; no effect on N-acylmannosamine kinase activity; impaired homohexamers formation
- 378 D → Y: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; corresponding to 10-30% of wild-type activity; decreased N-acylmannosamine kinase activity; impaired homohexamers formation; dbSNP:rs199877522
- 545 binding
- 566 binding
- 569 binding ; binding ; binding
- 572 V → L: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; retains 70-80% of wild-type activity; decreased N-acylmannosamine kinase activity; corresponding to less than 10% of wild-type activity; does not affect homohexamers formation; dbSNP:rs121908632
- 576 G → E: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; decreased N-acylmannosamine kinase activity; dbSNP:rs121908625
- 579 binding
- 581 binding
- 586 binding
- 587 I → T: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; decreased N-acylmannosamine kinase activity; dbSNP:rs748949603; I→T: Decreased N-acylmannosamine kinase activity.
- 588 binding ; binding
- 630 A → T: in NM; decreased N-acylmannosamine kinase activity; does not affect homohexamers formation; dbSNP:rs1382191649
- 631 A → T: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; retains 80% of wild-type activity; decreased N-acylmannosamine kinase activity; retains 75% of wild-type activity; dbSNP:rs121908626; A → V: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; retains 70% of wild-type activity; decreased N-acylmannosamine kinase activity; does not affect homohexamers formation; dbSNP:rs62541771; mutation A->V,T: Decreased N-acylmannosamine kinase activity.
- 708 G → S: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; decreased N-acylmannosamine kinase activity; severely decreased; dbSNP:rs1554657922
- 712 M→T: Decreased N-acylmannosamine kinase activity.
5f7rA Rok repressor lmo0178 from listeria monocytogenes bound to inducer (see paper)
23% identity, 64% coverage: 21:233/335 of query aligns to 5:211/306 of 5f7rA
- binding alpha-D-glucopyranose: K7 (≠ E23), E10 (≠ G26), G70 (≠ D86), N110 (≠ D125), N110 (≠ D125), S134 (≠ T149), V135 (= V150), G138 (= G153), L139 (≠ I154), G140 (= G155), E159 (= E172), H162 (= H175), E181 (= E199)
- binding zinc ion: H162 (= H175), C172 (≠ F187), C174 (= C191), C179 (= C197)
Sites not aligning to the query:
5f7qE Rok repressor lmo0178 from listeria monocytogenes bound to operator (see paper)
23% identity, 59% coverage: 21:219/335 of query aligns to 86:282/396 of 5f7qE
Sites not aligning to the query:
- binding : 5, 8, 12, 15, 32, 43, 44, 67, 68, 68, 69, 69, 70, 70, 71, 72, 73
3vglA Crystal structure of a rok family glucokinase from streptomyces griseus in complex with glucose and amppnp (see paper)
29% identity, 36% coverage: 22:143/335 of query aligns to 6:122/312 of 3vglA
Sites not aligning to the query:
- binding phosphoaminophosphonic acid-adenylate ester: 130, 131, 180, 214, 218, 260, 261, 264
- binding beta-D-glucopyranose: 133, 134, 153, 156, 175
- binding zinc ion: 156, 166, 168, 173
3vgkB Crystal structure of a rok family glucokinase from streptomyces griseus (see paper)
29% identity, 36% coverage: 22:143/335 of query aligns to 6:122/312 of 3vgkB
Sites not aligning to the query:
O35826 Bifunctional UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase; UDP-GlcNAc-2-epimerase/ManAc kinase; EC 3.2.1.183; EC 2.7.1.60 from Rattus norvegicus (Rat) (see paper)
28% identity, 39% coverage: 15:145/335 of query aligns to 405:537/722 of O35826
- D413 (≠ E23) mutation D->K,N: No effect on UDP-N-acetylglucosamine 2-epimerase activity. Does not affect feedback inhibition by CMP-Neu5Ac. Loss of N-acylmannosamine kinase activity. Does not interfere with oligomerization.
- R420 (≠ L30) mutation to M: No effect on UDP-N-acetylglucosamine 2-epimerase activity. Does not affect feedback inhibition by CMP-Neu5Ac. Loss of N-acylmannosamine kinase activity. Does not interfere with oligomerization.
Sites not aligning to the query:
- 1 UDP-N-acetylglucosamine 2-epimerase
- 49 H→A: Loss UDP-N-acetylglucosamine 2-epimerase activity. No effect on N-acylmannosamine kinase activity. Does not interfere with enzyme oligomerization.
- 110 H→A: Loss UDP-N-acetylglucosamine 2-epimerase activity. No effect on N-acylmannosamine kinase activity. Partial reduction of the dimerization process.
- 132 H→A: Loss UDP-N-acetylglucosamine 2-epimerase activity. No effect on N-acylmannosamine kinase activity. Partial reduction of the dimerization process.
- 155 H→A: Loss UDP-N-acetylglucosamine 2-epimerase activity. No effect on N-acylmannosamine kinase activity. Strong reduction of the dimerization process.
- 157 H→A: Loss UDP-N-acetylglucosamine 2-epimerase activity. No effect on N-acylmannosamine kinase activity. Strong reduction of the dimerization process.
- 406:722 N-acetylmannosamine kinase
7p9lAAA Ubiquitin-like protein SMT3,N-acetyl-D-glucosamine kinase
27% identity, 47% coverage: 23:179/335 of query aligns to 7:162/303 of 7p9lAAA
- binding 2-acetamido-2-deoxy-6-O-phosphono-beta-D-glucopyranose: P66 (≠ F80), G67 (= G81), S79 (≠ T98), N105 (≠ T124), D106 (= D125), G132 (= G151), T133 (= T152), G134 (= G153), V135 (≠ I154), G136 (= G155), E155 (= E172), H158 (= H175)
- binding zinc ion: H158 (= H175)
Sites not aligning to the query:
7p7wBBB Ubiquitin-like protein SMT3,N-acetyl-D-glucosamine kinase
27% identity, 47% coverage: 23:179/335 of query aligns to 10:165/306 of 7p7wBBB
Sites not aligning to the query:
7p9pAAA Ubiquitin-like protein SMT3,N-acetyl-D-glucosamine kinase
27% identity, 47% coverage: 23:179/335 of query aligns to 8:163/304 of 7p9pAAA
Sites not aligning to the query:
Query Sequence
>Ga0059261_1776 FitnessBrowser__Korea:Ga0059261_1776
MPLDSFGQAGLMGDEPLLLGAVEAGGTKFLCGIADRTGSVLAQTRIPTTTPAETLDAATA
FFAEHVARHGPLSAFSVGSFGPLSLDPIAPDYGSITSTPKPGWQDVDLLGYFRQMIDAPM
ALDTDVNCAAVGERLFGSGRGLDTFCYVTVGTGIGVGLLVGGAPHGGANHPEAGHIRLPR
APGDHDFAGICPFHGDCLEGLACGPAMKARWGAAAETLPGDHPAWDIEADYLAGLCATLT
YIVRPDRIILGGGVMESHLMHARVRRTLVAKLAGYDASMRSLDMDEYVVPPTAGPSAGLT
GAFALAYRIVTRQWPMHWAATGSLIAPSITEFANA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory