SitesBLAST
Comparing Ga0059261_1778 FitnessBrowser__Korea:Ga0059261_1778 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q96TU3 Extracellular exo-inulinase inuE; EC 3.2.1.80 from Aspergillus awamori (Black koji mold) (see 2 papers)
38% identity, 91% coverage: 26:484/502 of query aligns to 27:520/537 of Q96TU3
- N67 (≠ H66) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N111 (= N104) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N300 (≠ W268) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N398 (≠ P365) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N430 (≠ G398) modified: carbohydrate, N-linked (GlcNAc...) asparagine
Sites not aligning to the query:
1y9gA Crystal structure of exo-inulinase from aspergillus awamori complexed with fructose (see paper)
38% identity, 91% coverage: 26:484/502 of query aligns to 8:501/517 of 1y9gA
- active site: D22 (= D40), E222 (= E214)
- binding beta-D-fructofuranose: N21 (= N39), D22 (= D40), Q38 (= Q56), W46 (= W64), F83 (= F95), S84 (= S96), R169 (= R161), D170 (= D162), E222 (= E214), Y294 (= Y282), W316 (= W306)
O94220 Extracellular endo-inulinase inu2; 2,1-beta-D-fructanfructanohydrolase; Inulase; EC 3.2.1.7 from Aspergillus ficuum (see 2 papers)
34% identity, 95% coverage: 14:488/502 of query aligns to 17:505/516 of O94220
- M41 (= M38) mutation to A: Decreases catalytic activity.
- N42 (= N39) mutation to G: Strongly decreases catalytic activity.
- E43 (≠ D40) mutation to D: Strongly decreases catalytic activity.
- Q59 (= Q56) mutation to A: Impairs catalytic activity.
- N61 (= N58) binding
- P62 (= P59) mutation to G: Impairs catalytic activity.
- W67 (= W64) mutation to A: Impairs catalytic activity.
- I70 (≠ M67) mutation to A: Decreases catalytic activity.
- F99 (= F95) mutation to A: Strongly decreases catalytic activity.
- R175 (= R161) mutation to A: Impairs catalytic activity.
- D176 (= D162) binding
- N265 (≠ S248) mutation to A: Decreases catalytic activity.
- R295 (≠ A279) mutation to A: Decreases catalytic activity.
- D298 (≠ Y282) mutation to A: Decreases catalytic activity.
- N320 (= N304) binding
- N372 (≠ A358) modified: carbohydrate, N-linked (GlcNAc...) asparagine
3rwkX First crystal structure of an endo-inulinase, from aspergillus ficuum: structural analysis and comparison with other gh32 enzymes. (see paper)
34% identity, 93% coverage: 21:488/502 of query aligns to 1:482/493 of 3rwkX
- binding beta-D-fructofuranose: W17 (= W37), M18 (= M38), N19 (= N39), E20 (≠ D40), N38 (= N58), F76 (= F95), T77 (≠ S96), R152 (= R161), D153 (= D162), E210 (= E214), N297 (= N304), G300 (≠ A309)
- binding alpha-D-mannopyranose: G241 (= G247), N242 (≠ S248), R272 (≠ A279), R272 (≠ A279), S298 (≠ R307), D417 (= D425), P418 (≠ G426), P418 (≠ G426), A419 (≠ F427)
P00724 Invertase 2; Beta-fructofuranosidase 2; Saccharase; EC 3.2.1.26 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 2 papers)
34% identity, 92% coverage: 11:473/502 of query aligns to 14:505/532 of P00724
- N23 (≠ A20) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- D42 (= D40) active site; mutation to N: Loss of activity.
- N64 (≠ H60) modified: carbohydrate, N-linked (GlcNAc...) asparagine; partial
- N97 (≠ T90) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N111 (= N104) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N118 (≠ K111) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N165 (= N156) modified: carbohydrate, N-linked (GlcNAc...) asparagine; partial
- N266 (≠ D258) modified: carbohydrate, N-linked (GlcNAc...) asparagine; partial
- N275 (≠ A270) modified: carbohydrate, N-linked (GlcNAc...) asparagine; partial
- N356 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N369 (≠ A358) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N384 (≠ I370) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N398 (≠ G384) modified: carbohydrate, N-linked (GlcNAc...) asparagine
Sites not aligning to the query:
- 1:19 signal peptide
- 512 modified: carbohydrate, N-linked (GlcNAc...) asparagine; partial
6s2bA Structure of beta-fructofuranosidase from schwanniomyces occidentalis complexed with fructosyl-erythritol (see paper)
33% identity, 89% coverage: 26:473/502 of query aligns to 13:483/512 of 6s2bA
- active site: A27 (≠ D40), E207 (= E214)
- binding (2~{S},3~{R})-4-[(2~{R},3~{S},4~{S},5~{R})-2,5-bis(hydroxymethyl)-3,4-bis(oxidanyl)oxolan-2-yl]oxybutane-1,2,3-triol: N26 (= N39), Q45 (= Q56), W53 (= W64), F87 (= F95), S88 (= S96), R155 (= R161), D156 (= D162), E207 (= E214), Y270 (= Y282), W291 (= W306)
6s1tA Structure of beta-fructofuranosidase from schwanniomyces occidentalis complexed with sucrose (see paper)
33% identity, 89% coverage: 26:473/502 of query aligns to 13:483/512 of 6s1tA
- active site: A27 (≠ D40), E207 (= E214)
- binding beta-D-fructofuranose: N26 (= N39), Q45 (= Q56), F87 (= F95), S88 (= S96), R155 (= R161), D156 (= D162), E207 (= E214), Y270 (= Y282)
- binding alpha-D-glucopyranose: W53 (= W64), E207 (= E214), W291 (= W306)
8beqA Structure of fructofuranosidase from rhodotorula dairenensis (see paper)
33% identity, 88% coverage: 26:465/502 of query aligns to 35:497/534 of 8beqA
Sites not aligning to the query:
8betA Structure of d188a-fructofuranosidase from rhodotorula dairenesis in complex with sucrose (see paper)
33% identity, 88% coverage: 26:465/502 of query aligns to 33:489/525 of 8betA
- binding beta-D-fructofuranose: N46 (= N39), Q64 (= Q56), Q75 (≠ M67), S106 (= S96), R170 (= R161), D171 (= D162), E221 (= E214)
- binding alpha-D-glucopyranose: F105 (= F95), E221 (= E214), N246 (≠ G240)
- binding alpha-D-mannopyranose: P92 (= P84), Y151 (≠ R143), S316 (≠ W315), A317 (≠ P316)
Sites not aligning to the query:
8besA Structure of d188a-fructofuranosidase from rhodotorula dairenensis in complex with fructose (see paper)
33% identity, 88% coverage: 26:465/502 of query aligns to 33:490/526 of 8besA
Sites not aligning to the query:
7vcpA Frischella perrara beta-fructofuranosidase in complex with fructose (see paper)
31% identity, 98% coverage: 8:498/502 of query aligns to 6:488/490 of 7vcpA
4ffgA Crystal structure of levan fructotransferase from arthrobacter ureafaciens in complex with dfa-iv (see paper)
32% identity, 91% coverage: 29:486/502 of query aligns to 3:467/480 of 4ffgA
- active site: D14 (= D40), E196 (= E214)
- binding (1R,4R,5S,6S,7R,10R,11S,12S)-1,7-bis(hydroxymethyl)-2,8,13,14-tetraoxatricyclo[8.2.1.1~4,7~]tetradecane-5,6,11,12-tetrol: N368 (≠ Q388), Y393 (≠ F413), D395 (= D415), R411 (= R430), D463 (≠ R482)
- binding beta-D-fructofuranose: D128 (≠ G155), Y167 (≠ T185), N184 (≠ S202), D186 (≠ G204)
4ffhA Crystal structure of levan fructotransferase d54n mutant from arthrobacter ureafaciens in complex with sucrose (see paper)
31% identity, 91% coverage: 29:486/502 of query aligns to 3:467/480 of 4ffhA
- active site: N14 (≠ D40), E196 (= E214)
- binding beta-D-fructofuranose: N14 (≠ D40), W68 (≠ F95), S69 (= S96), R145 (= R161), D146 (= D162), E196 (= E214), Y258 (= Y282), N368 (≠ Q388), N384 (≠ G404), Y388 (≠ T408), Y393 (≠ F413), D395 (= D415), R411 (= R430)
- binding alpha-D-glucopyranose: R99 (≠ T128), R145 (= R161), E196 (= E214)
2qquA Crystal structure of a cell-wall invertase (d239a) from arabidopsis thaliana in complex with sucrose (see paper)
29% identity, 94% coverage: 26:499/502 of query aligns to 5:535/535 of 2qquA
- active site: D19 (= D40), E199 (= E214)
- binding beta-D-fructofuranose: D19 (= D40), Q35 (= Q56), W78 (= W103), S79 (≠ N104), R144 (= R161), D145 (= D162), E199 (= E214)
- binding alpha-D-glucopyranose: W43 (= W64), W78 (= W103), E199 (= E214)
- binding alpha-D-mannopyranose: Q392 (= Q397), S396 (≠ T401)
- binding zinc ion: H190 (≠ P205), D192 (≠ G207), M262 (vs. gap)
7bwcA Bombyx mori gh32 beta-fructofuranosidase bmsuc1 mutant d63a in complex with sucrose (see paper)
30% identity, 97% coverage: 9:496/502 of query aligns to 4:459/464 of 7bwcA
- binding beta-D-fructofuranose: N38 (= N39), Q55 (= Q56), M66 (= M67), F94 (= F95), S95 (= S96), R156 (= R161), D157 (= D162), E210 (= E214), W293 (= W306)
- binding alpha-D-glucopyranose: W63 (= W64), E210 (= E214), Q228 (≠ E224), W293 (= W306)
2ac1A Crystal structure of a cell-wall invertase from arabidopsis thaliana (see paper)
29% identity, 94% coverage: 26:499/502 of query aligns to 5:535/537 of 2ac1A
Q43866 Beta-fructofuranosidase, insoluble isoenzyme CWINV1; Cell wall beta-fructosidase 1; AtbetaFRUCT1; Cell wall invertase 1; AtcwINV1; Sucrose hydrolase 1; EC 3.2.1.26 from Arabidopsis thaliana (Mouse-ear cress) (see 5 papers)
29% identity, 94% coverage: 26:499/502 of query aligns to 52:582/584 of Q43866
- W63 (= W37) mutation to L: Loss of activity.
- D66 (= D40) mutation to A: Loss of activity.
- W90 (= W64) mutation to L: Loss of activity.
- W125 (= W103) mutation to L: Loss of activity.
- E246 (= E214) mutation E->A,Q: Loss of activity.
- D282 (≠ G240) mutation to A: Impaired beta-fructofuranosidase activity but enhanced 1-fructan exohydrolase activity.; mutation to F: Loss of activity.; mutation to N: Normal activity.
- K285 (≠ S248) mutation to L: Slightly reduced activity.
- N342 (= N304) mutation to D: Reduced activity and glycosylation.
2oxbA Crystal structure of a cell-wall invertase (e203q) from arabidopsis thaliana in complex with sucrose (see paper)
29% identity, 94% coverage: 26:499/502 of query aligns to 5:535/537 of 2oxbA
6nunA Structure of gh32 hydrolase from bifidobacterium adolescentis in complex with frutose
28% identity, 94% coverage: 27:500/502 of query aligns to 39:512/516 of 6nunA
Q39041 Acid beta-fructofuranosidase 4, vacuolar; At beta fruct4; AtBETAFRUCT4; Acid invertase 4; AI 4; Acid sucrose hydrolase 4; Vacuolar invertase 4; Inv-V4; VAC-INV 4; VI 4; EC 3.2.1.26 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
28% identity, 94% coverage: 26:497/502 of query aligns to 121:647/664 of Q39041
Sites not aligning to the query:
- 2 mutation Missing: No effect on localization.
- 3 mutation Missing: Partial retention in the endoplasmic reticulum.
- 3:4 mutation Missing: Endoplasmic reticulum localization.
- 4 mutation Missing: Partial retention in the endoplasmic reticulum.
- 5 mutation Missing: Endoplasmic reticulum localization.
- 6 mutation Missing: No effect on localization.
- 7 mutation Missing: Partial retention in the endoplasmic reticulum.
- 7:8 Critical for endoplasmic reticulum export; LL→AA: Reduced vacuolar trafficking.; mutation Missing: Endoplasmic reticulum localization.
- 8 mutation Missing: Partial retention in the endoplasmic reticulum.
- 9 P→A: Partial retention in the endoplasmic reticulum.
- 9:10 Critical for endoplasmic reticulum export; PI→AA: Reduced vacuolar trafficking.
- 10 mutation Missing: Endoplasmic reticulum localization.
- 11 mutation Missing: Endoplasmic reticulum localization.
- 12 mutation Missing: No effect on localization.
- 14:16 Critical for trafficking from the trans-Golgi network to the prevacuolar compartment and from the prevacuolar compartment to the central vacuole; EEE→AAA: Reduced vacuolar trafficking.
- 18:21 LCPY→AAAA: Reduced vacuolar trafficking.
- 21:24 YTRL→AAAA: Reduced vacuolar trafficking.; mutation Missing: No effect on localization.
Query Sequence
>Ga0059261_1778 FitnessBrowser__Korea:Ga0059261_1778
MKKLAILLTAAAVLASAASAQQADVRPGYHYGPARNWMNDPNGLVYYDGEYHLFYQYNPH
GDRWGHMNWGHAVSRDLVNWEELPVAIPETDVMAFSGTAVIDWNNTTGFGKNGKPPMIAI
YTGHDPKTERQSQYLAYSNDRGRTFTIHGEVLNAGNEKHFRDPKVFWHAPTRRWVMVVLK
AAANTAEIYTSPNLKDWTHRSSFGPAGGRGKFWECPDLFELPVEGGAPGETRWVLSINLG
DNAIGGGSGGQYFVGDFDGEKFTLVPGWPAAPQWMDYGADFYATISWNDMPKGDPRRVWM
GWANDWRYAEAIPTWPARGIMTVARTVALRKTAEGYHLLQAPVRELATLRGTPQRAPALA
LSETPVPLPIEGGKADIELELDTGTADQVSIALTDGQGWQTRIGVNPTVNEVFVDRTRSG
PHFHDGFANRHVAPVDLKSRKVKLRVLADESIVEVFVNDGRQTITDRFYRGGGALTWSAT
ARGGKATMNLTAWPMRSMESRK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory