SitesBLAST
Comparing Ga0059261_1809 FitnessBrowser__Korea:Ga0059261_1809 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8i9iA Glutamyl-tRNA synthetase from escherichia coli bound to glutamate and zinc
35% identity, 95% coverage: 2:268/280 of query aligns to 3:266/468 of 8i9iA
P04805 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Escherichia coli (strain K12) (see 4 papers)
35% identity, 95% coverage: 2:268/280 of query aligns to 3:266/471 of P04805
- C98 (= C97) mutation to S: 10-fold decrease in activity. Strong decrease in zinc content.
- C100 (= C99) mutation to S: Loss of activity. Strong decrease in zinc content.; mutation to Y: Does not prevent zinc binding. Reduces only 2-fold the binding affinity for tRNA(Glu), but reduces more than 10-fold the affinity for glutamate in the presence of tRNA(Glu).
- C125 (= C123) mutation to S: Loss of activity. Strong decrease in zinc content.
- H127 (≠ R133) mutation to Q: 10-fold decrease in activity. Strong decrease in zinc content.
- H129 (= H135) mutation to Q: No change in activity or in zinc content.
- H131 (≠ W137) mutation to Q: No change in activity or in zinc content.
- H132 (≠ R138) mutation to Q: No change in activity or in zinc content.
- C138 (≠ A144) mutation to S: No change in activity or in zinc content.
- S239 (≠ A241) modified: Phosphoserine; mutation to D: Does not aminoacylate tRNA(Glu), not phosphorylated by HipA.
P27305 Glutamyl-Q tRNA(Asp) synthetase; Glu-Q-RSs; EC 6.1.1.- from Escherichia coli (strain K12) (see paper)
43% identity, 88% coverage: 3:249/280 of query aligns to 17:248/308 of P27305
- E55 (= E41) binding
- Y182 (= Y183) binding
- R200 (= R201) binding
4a91A Crystal structure of the glutamyl-queuosine trnaasp synthetase from e. Coli complexed with l-glutamate (see paper)
43% identity, 88% coverage: 3:249/280 of query aligns to 5:234/290 of 4a91A
- active site: S11 (= S9), K229 (= K242)
- binding glutamic acid: R7 (= R5), A9 (= A7), S11 (= S9), E43 (= E41), Y170 (= Y183), R188 (= R201), L192 (= L205)
- binding zinc ion: C99 (= C97), C101 (= C99), Y113 (= Y119), C117 (= C123)
Q8DLI5 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1) (see paper)
37% identity, 95% coverage: 2:266/280 of query aligns to 3:275/485 of Q8DLI5
- R6 (= R5) binding
- Y192 (= Y183) binding
2cfoA Non-discriminating glutamyl-tRNA synthetase from thermosynechococcus elongatus in complex with glu (see paper)
37% identity, 95% coverage: 2:266/280 of query aligns to 2:274/484 of 2cfoA
4g6zA Crystal structure of a glutamyl-tRNA synthetase glurs from burkholderia thailandensis bound to l-glutamate (see paper)
34% identity, 95% coverage: 4:268/280 of query aligns to 5:251/380 of 4g6zA
1g59A Glutamyl-tRNA synthetase complexed with tRNA(glu). (see paper)
33% identity, 99% coverage: 1:276/280 of query aligns to 1:276/468 of 1g59A
- binding : D44 (= D44), R45 (≠ G45), A46 (≠ T46), R47 (= R47), P109 (≠ R101), V145 (≠ C136), R163 (= R159), V166 (= V162), E172 (≠ S168), V177 (= V173), K180 (≠ R176), S181 (≠ K177), D182 (= D178), E207 (= E203), E208 (≠ D204), R237 (≠ T233), K241 (≠ G237), T242 (≠ E238), K243 (≠ R239), M273 (≠ I273), G274 (= G274)
Sites not aligning to the query:
- binding : 282, 299, 300, 303, 304, 309, 312, 319, 357, 358, 417, 426, 427, 432, 435, 442, 443, 444, 445, 446, 447, 448
2cv2A Glutamyl-tRNA synthetase from thermus thermophilus in complex with tRNA(glu) and an enzyme inhibitor, glu-ams (see paper)
33% identity, 99% coverage: 1:276/280 of query aligns to 1:276/468 of 2cv2A
- active site: K246 (= K242)
- binding o5'-(l-glutamyl-sulfamoyl)-adenosine: R5 (= R5), A7 (= A7), S9 (= S9), G17 (= G17), I21 (≠ S21), E41 (= E41), Y187 (= Y183), R205 (= R201), A206 (≠ G202), E208 (≠ D204), W209 (≠ L205), L235 (= L231), L236 (= L232)
- binding : S9 (= S9), T43 (≠ I43), D44 (= D44), R47 (= R47), V145 (≠ C136), R163 (= R159), Y168 (≠ A164), E172 (≠ S168), V177 (= V173), K180 (≠ R176), S181 (≠ K177), Y187 (= Y183), E207 (= E203), E208 (≠ D204), W209 (≠ L205), V211 (≠ A207), R237 (≠ T233), K241 (≠ G237), L272 (≠ P272), M273 (≠ I273), G274 (= G274)
Sites not aligning to the query:
- binding : 282, 299, 303, 304, 309, 312, 319, 357, 358, 417, 432, 435, 442, 443, 444, 446, 447, 448
2cv1A Glutamyl-tRNA synthetase from thermus thermophilus in complex with tRNA(glu), atp, and an analog of l-glutamate: a quaternary complex
33% identity, 99% coverage: 1:276/280 of query aligns to 1:276/468 of 2cv1A
- active site: K246 (= K242)
- binding adenosine-5'-triphosphate: P8 (= P8), S9 (= S9), G17 (= G17), T18 (≠ H18), I21 (≠ S21), R47 (= R47), A206 (≠ G202), W209 (≠ L205), L235 (= L231), L236 (= L232)
- binding (4s)-4-amino-5-hydroxypentanoic acid: R5 (= R5), A7 (= A7), E41 (= E41), Y187 (= Y183), R205 (= R201), W209 (≠ L205)
- binding : S9 (= S9), E41 (= E41), T43 (≠ I43), D44 (= D44), R47 (= R47), V145 (≠ C136), R163 (= R159), V166 (= V162), E172 (≠ S168), V177 (= V173), K180 (≠ R176), S181 (≠ K177), Y187 (= Y183), E207 (= E203), E208 (≠ D204), W209 (≠ L205), V211 (≠ A207), R237 (≠ T233), K241 (≠ G237), K243 (≠ R239), M273 (≠ I273), G274 (= G274), S276 (≠ A276)
Sites not aligning to the query:
- binding : 282, 299, 303, 304, 309, 312, 319, 357, 358, 417, 427, 432, 435, 442, 443, 444, 446, 447, 448
2cuzA Glutamyl-tRNA synthetase from thermus thermophilus in complex with l-glutamate (see paper)
33% identity, 99% coverage: 1:276/280 of query aligns to 1:276/468 of 2cuzA
1n78A Crystal structure of thermus thermophilus glutamyl-tRNA synthetase complexed with tRNA(glu) and glutamol-amp. (see paper)
33% identity, 99% coverage: 1:276/280 of query aligns to 1:276/468 of 1n78A
- active site: K246 (= K242)
- binding glutamol-amp: R5 (= R5), A7 (= A7), P8 (= P8), S9 (= S9), G17 (= G17), T18 (≠ H18), I21 (≠ S21), E41 (= E41), Y187 (= Y183), N191 (≠ V187), R205 (= R201), A206 (≠ G202), E208 (≠ D204), W209 (≠ L205), L235 (= L231), L236 (= L232)
- binding : S9 (= S9), T43 (≠ I43), D44 (= D44), R47 (= R47), V145 (≠ C136), R163 (= R159), V166 (= V162), Y168 (≠ A164), E172 (≠ S168), V177 (= V173), K180 (≠ R176), S181 (≠ K177), Y187 (= Y183), E207 (= E203), E208 (≠ D204), W209 (≠ L205), L210 (≠ I206), V211 (≠ A207), R237 (≠ T233), K241 (≠ G237), M273 (≠ I273), G274 (= G274)
Sites not aligning to the query:
- binding : 282, 297, 303, 304, 309, 312, 319, 357, 358, 417, 427, 432, 435, 442, 443, 444, 446, 447, 448
1j09A Crystal structure of thermus thermophilus glutamyl-tRNA synthetase complexed with atp and glu (see paper)
33% identity, 99% coverage: 1:276/280 of query aligns to 1:276/468 of 1j09A
- active site: K246 (= K242)
- binding adenosine-5'-triphosphate: H15 (= H15), E208 (≠ D204), L235 (= L231), L236 (= L232), K243 (≠ R239), I244 (≠ L240), S245 (≠ A241), K246 (= K242), R247 (= R243)
- binding glutamic acid: R5 (= R5), A7 (= A7), S9 (= S9), E41 (= E41), Y187 (= Y183), N191 (≠ V187), R205 (= R201), W209 (≠ L205)
P27000 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
33% identity, 99% coverage: 1:276/280 of query aligns to 1:276/468 of P27000
Sites not aligning to the query:
- 358 R→Q: Reduces affinity for tRNA and abolishes the ability to discriminate between tRNA(Glu) and tRNA(Gln).
3al0C Crystal structure of the glutamine transamidosome from thermotoga maritima in the glutamylation state. (see paper)
30% identity, 95% coverage: 1:266/280 of query aligns to 102:359/564 of 3al0C
- active site: S110 (= S9), K335 (= K242)
- binding o5'-(l-glutamyl-sulfamoyl)-adenosine: R106 (= R5), A108 (= A7), P109 (= P8), G118 (= G17), T122 (≠ S21), E142 (= E41), Y276 (= Y183), R294 (= R201), G295 (= G202), D297 (= D204), H298 (≠ L205), L324 (= L231), I325 (≠ L232), L333 (= L240)
- binding : T144 (≠ I43), D145 (= D44), R148 (= R47), Y208 (= Y95), P213 (≠ T100), K252 (≠ R159), M255 (≠ V162), I266 (≠ V173), K269 (≠ R176), S270 (≠ K177), Y276 (= Y183), D297 (= D204), H298 (≠ L205), L299 (≠ I206), S300 (≠ A207), N301 (≠ A208), K304 (≠ V211), R330 (≠ G237), P332 (≠ R239)
Sites not aligning to the query:
- binding : 363, 364, 365, 370, 387, 389, 391, 392, 397, 400, 407, 446, 447, 453, 457, 509, 520, 524, 527, 535, 536, 538, 539
4griB Crystal structure of a glutamyl-tRNA synthetase glurs from borrelia burgdorferi bound to glutamic acid and zinc (see paper)
33% identity, 91% coverage: 4:259/280 of query aligns to 4:267/485 of 4griB
- active site: S9 (= S9), K253 (= K242)
- binding glutamic acid: R5 (= R5), A7 (= A7), S9 (= S9), E41 (= E41), Y194 (= Y183), R212 (= R201), W216 (≠ L205)
- binding zinc ion: C105 (= C97), C107 (= C99), Y128 (= Y119), C132 (= C123)
8vc5A Crystal structure of glutamyl-tRNA synthetase glurs from pseudomonas aeruginosa (zinc bound)
31% identity, 95% coverage: 2:268/280 of query aligns to 4:280/488 of 8vc5A
6brlA Crystal structure of a glutamate tRNA ligase from elizabethkingia meningosepticum ccug26117 in complex with its amino acid
28% identity, 86% coverage: 4:245/280 of query aligns to 5:264/502 of 6brlA
3aiiA Archaeal non-discriminating glutamyl-tRNA synthetase from methanothermobacter thermautotrophicus (see paper)
48% identity, 35% coverage: 2:99/280 of query aligns to 11:107/455 of 3aiiA
Sites not aligning to the query:
1o0cA Crystal structure of l-glutamate and ampcpp bound to glutamine aminoacyl tRNA synthetase (see paper)
37% identity, 33% coverage: 4:95/280 of query aligns to 22:113/529 of 1o0cA
Sites not aligning to the query:
- binding adenosine monophosphate: 223, 253, 254, 263
- binding glutamic acid: 204, 208, 222
- binding : 6, 119, 123, 126, 128, 129, 130, 161, 174, 175, 176, 185, 187, 203, 204, 226, 227, 228, 231, 306, 309, 310, 311, 313, 314, 316, 318, 319, 322, 329, 334, 362, 392, 394, 395, 403, 405, 406, 435, 499, 501, 502, 527
Query Sequence
>Ga0059261_1809 FitnessBrowser__Korea:Ga0059261_1809
MIVTRFAPSPTGRLHLGHAFSAIRAHDFARERNGRFLVRIEDIDGTRSRPEHVETILRDL
EWLGLGWDGEVVFQSQRLARYEAALDRLRAAGLLYPCFCTRADIAASVSAPHGPEGPVYP
GTCRALVSPDLSRPHCWRIDMAKALATVSTPLTFEEGGRGRVEADPLSHGDVVLARKDAP
ASYHLAVTIDDAAQQVTDIVRGEDLIAATHVHRLLQALLGLPVPRYHHHALLTGADGERL
AKRHGAPTLAALREAGEDGRALAETLRRGELPIGFAAAKA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory