Comparing Ga0059261_1822 FitnessBrowser__Korea:Ga0059261_1822 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
3e4dA Structural and kinetic study of an s-formylglutathione hydrolase from agrobacterium tumefaciens (see paper)
58% identity, 99% coverage: 3:278/279 of query aligns to 2:277/278 of 3e4dA
3i6yA Structure of an esterase from the oil-degrading bacterium oleispira antarctica (see paper)
51% identity, 100% coverage: 2:279/279 of query aligns to 1:277/278 of 3i6yA
3s8yA Bromide soaked structure of an esterase from the oil-degrading bacterium oleispira antarctica (see paper)
51% identity, 100% coverage: 2:279/279 of query aligns to 1:277/277 of 3s8yA
P10768 S-formylglutathione hydrolase; FGH; Esterase D; Methylumbelliferyl-acetate deacetylase; EC 3.1.2.12; EC 3.1.1.56 from Homo sapiens (Human) (see 4 papers)
51% identity, 100% coverage: 1:279/279 of query aligns to 1:281/282 of P10768
3fcxB Crystal structure of human esterase d (see paper)
50% identity, 99% coverage: 3:279/279 of query aligns to 1:275/275 of 3fcxB
P33018 S-formylglutathione hydrolase YeiG; FGH; EC 3.1.2.12 from Escherichia coli (strain K12) (see paper)
47% identity, 99% coverage: 3:278/279 of query aligns to 1:276/278 of P33018
3fcxA Crystal structure of human esterase d (see paper)
49% identity, 100% coverage: 1:279/279 of query aligns to 1:267/268 of 3fcxA
Q8LAS8 S-formylglutathione hydrolase; AtSFGH; Esterase D; EC 3.1.2.12 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
48% identity, 99% coverage: 3:279/279 of query aligns to 5:283/284 of Q8LAS8
P40363 S-formylglutathione hydrolase; FGH; EC 3.1.2.12 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
42% identity, 92% coverage: 21:278/279 of query aligns to 19:296/299 of P40363
Sites not aligning to the query:
4flmA S-formylglutathione hydrolase w197i variant containing copper (see paper)
41% identity, 92% coverage: 21:278/279 of query aligns to 19:285/288 of 4flmA
Sites not aligning to the query:
>Ga0059261_1822 FitnessBrowser__Korea:Ga0059261_1822
MTLETLSTNKAHDGTQGVYRHASTATGTPMTFSVFVPDHAEGAKLPVLWYLSGLTCTHAN
VTEKGEYRAACAEHGVIFIAPDTSPRGDAVPDDEAYDFGKGAGFYVDATEEPWAANFRMR
SYVEDELPALILREFPQADLSRQGITGHSMGGHGALTIGLRNPDRFRSVSAFAPICAPSQ
CPWGEKALTGYLGGDREDWRAYDACAMIADGLRIAELLVDQGDADAFLSEQLKPELLAQA
CQDAGIDLTLRMQPGYDHSYYFISTFLPEHVAWHAARLK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory