Comparing Ga0059261_1870 FitnessBrowser__Korea:Ga0059261_1870 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7d0aB Acinetobacter mlafedb complex in adp-vanadate trapped vclose conformation (see paper)
37% identity, 89% coverage: 13:255/273 of query aligns to 2:242/263 of 7d0aB
7d08B Acinetobacter mlafedb complex in atp-bound vtrans1 conformation (see paper)
37% identity, 89% coverage: 13:255/273 of query aligns to 2:242/263 of 7d08B
6z5uK Cryo-em structure of the a. Baumannii mlabdef complex bound to appnhp (see paper)
37% identity, 89% coverage: 14:255/273 of query aligns to 1:240/253 of 6z5uK
7chaI Cryo-em structure of p.Aeruginosa mlafebd with amppnp (see paper)
36% identity, 88% coverage: 16:255/273 of query aligns to 4:241/262 of 7chaI
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
38% identity, 79% coverage: 32:247/273 of query aligns to 22:232/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
37% identity, 79% coverage: 32:247/273 of query aligns to 23:233/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
37% identity, 79% coverage: 32:247/273 of query aligns to 23:233/344 of 3tuiC
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
37% identity, 79% coverage: 32:247/273 of query aligns to 23:233/344 of 6cvlD
Sites not aligning to the query:
7ch8I Cryo-em structure of p.Aeruginosa mlafebd with adp-v (see paper)
35% identity, 88% coverage: 16:255/273 of query aligns to 4:238/259 of 7ch8I
Q9AT00 Protein TRIGALACTOSYLDIACYLGLYCEROL 3, chloroplastic; ABC transporter I family member 13; ABC transporter ABCI.13; AtABCI13; Non-intrinsic ABC protein 11; AtNAP11 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
34% identity, 90% coverage: 11:255/273 of query aligns to 80:337/345 of Q9AT00
7ch6C Cryo-em structure of e.Coli mlafeb with amppnp (see paper)
35% identity, 88% coverage: 15:255/273 of query aligns to 4:242/265 of 7ch6C
6xgyA Crystal structure of e. Coli mlafb abc transport subunits in the dimeric state (see paper)
35% identity, 88% coverage: 15:255/273 of query aligns to 4:242/264 of 6xgyA
7cgnB The overall structure of the mlafedb complex in atp-bound eqtall conformation (mutation of e170q on mlaf) (see paper)
35% identity, 88% coverage: 15:255/273 of query aligns to 4:242/263 of 7cgnB
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
35% identity, 77% coverage: 35:243/273 of query aligns to 46:252/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
35% identity, 77% coverage: 35:243/273 of query aligns to 46:252/382 of 7aheC
Sites not aligning to the query:
7ahdC Opua (e190q) occluded (see paper)
34% identity, 77% coverage: 35:243/273 of query aligns to 46:252/260 of 7ahdC
Sites not aligning to the query:
4yerA Crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution
34% identity, 84% coverage: 13:241/273 of query aligns to 2:223/285 of 4yerA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
34% identity, 84% coverage: 15:242/273 of query aligns to 1:224/240 of 4ymuJ
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
33% identity, 88% coverage: 3:241/273 of query aligns to 11:235/378 of P69874
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
33% identity, 84% coverage: 15:243/273 of query aligns to 2:225/241 of 4u00A
>Ga0059261_1870 FitnessBrowser__Korea:Ga0059261_1870
MNPGSTGPIFDGEAVIRVRGLRNSFGEQVVHEGLDLDVRQGEILGVVGGSGTGKSVLMRS
IIGLQEPDAGSIEVFGEDVQHLNTEEAIELRKRWGVLFQGGALFSTLTVAENVQVPLKEF
YPAFDQALLDEIAAYKVVMTGLPSDAGPKYPAELSGGMKKRAGLARSLALDPELLFLDEP
TAGLDPIGAAAFDELTLALQRTLGLTVFLITHDLDTLYAICDRVAVLADKHVIAVGTIDE
LLALDHPWIQEYFNGPRGRAAVSSVERAEARAT
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory