SitesBLAST
Comparing Ga0059261_1891 FitnessBrowser__Korea:Ga0059261_1891 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0AGF4 D-xylose-proton symporter; D-xylose transporter from Escherichia coli (strain K12) (see paper)
38% identity, 99% coverage: 4:465/466 of query aligns to 2:475/491 of P0AGF4
- F24 (= F26) mutation to A: Decreases xylose transport.
- G83 (= G77) mutation to A: Abolishes xylose transport.
- R133 (= R109) mutation R->C,H,L: Abolishes xylose transport.
- E153 (= E129) mutation to A: Abolishes xylose transport.
- R160 (= R136) mutation to A: Abolishes xylose transport.
- Q168 (= Q144) binding ; mutation to A: Abolishes xylose transport.
- Q288 (= Q272) mutation to A: Abolishes xylose transport.
- QQ 288:289 (= QQ 272:273) binding
- Q289 (= Q273) mutation to A: Strongly decreases xylose transport.
- N294 (= N278) binding ; mutation to A: Abolishes xylose transport.
- Y298 (= Y282) mutation to A: Abolishes xylose transport.
- N325 (≠ S309) mutation to A: No effect on xylose transport.
- G340 (= G324) mutation to A: Abolishes xylose transport.
- R341 (= R325) mutation R->A,W: Abolishes xylose transport.
- W392 (= W388) binding ; mutation to A: Abolishes xylose transport.
- E397 (= E393) mutation to A: Abolishes xylose transport.
- R404 (= R400) mutation to A: Strongly decreases xylose transport.
- Q415 (= Q411) binding
- W416 (= W412) mutation to A: Strongly decreases xylose transport.
4gc0A The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to 6-bromo-6-deoxy-d-glucose (see paper)
38% identity, 98% coverage: 8:465/466 of query aligns to 2:471/475 of 4gc0A
4gbzA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-glucose (see paper)
38% identity, 98% coverage: 8:465/466 of query aligns to 2:471/475 of 4gbzA
4gbyA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-xylose (see paper)
38% identity, 98% coverage: 8:465/466 of query aligns to 2:471/475 of 4gbyA
A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
32% identity, 94% coverage: 27:465/466 of query aligns to 20:434/446 of A0A0H2VG78
- D22 (= D29) mutation to N: Affects symport activity. May function as an uniporter.
- R102 (= R109) mutation to A: Loss of transport activity.
- I105 (≠ G112) mutation to S: Affects symport activity. May function as an uniporter.
- E122 (= E129) mutation to A: Loss of transport activity.
- Q137 (= Q144) mutation to A: Loss of transport activity.
- Q250 (= Q272) mutation to A: Loss of transport activity.
- Q251 (= Q273) mutation to A: Loss of transport activity.
- N256 (= N278) mutation to A: Loss of transport activity.
- W357 (= W388) mutation to A: Loss of transport activity.
Q8VZR6 Inositol transporter 1 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
31% identity, 97% coverage: 12:465/466 of query aligns to 31:476/509 of Q8VZR6
Sites not aligning to the query:
- 479:509 mutation Missing: Leads to endoplasmic reticulum relocalization.
- 481:482 ER→AA: No effect on targeting.
- 500:509 mutation Missing: Leads to endoplasmic reticulum relocalization.
- 502:504 mutation LLE->AAA,SSS: Leads to plasma membrane relocalization.
Q9LT15 Sugar transport protein 10; AtSTP10; D-glucose-H(+) symport protein STP10; D-glucose-proton symporter STP10; Hexose transporter 10 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
29% identity, 96% coverage: 18:464/466 of query aligns to 31:485/514 of Q9LT15
- F39 (= F26) mutation to A: Reduces affinity for glucose 8-fold.
- L43 (vs. gap) mutation to A: Reduces affinity for glucose 150-fold and turns STP10 into a low affinity transporter.
- C77 (vs. gap) modified: Disulfide link with 449; mutation to A: Increases sensitivity to alkaline pH and can only function fully at acidic pH (pH < 5).
- E162 (= E129) mutation to Q: Abolishes glucose transport activity; when associated with N-344.
- Q177 (= Q144) binding ; mutation to A: Reduces affinity for glucose 37-fold.
- I184 (≠ L151) mutation to A: Reduces affinity for glucose 3-fold.
- Q295 (= Q272) binding
- Q296 (= Q273) binding
- N301 (= N278) binding
- N332 (≠ S309) binding
- D344 (= D321) mutation to N: Abolishes glucose transport activity; when associated with Q-162.
- W410 (= W388) binding
- C449 (≠ A427) modified: Disulfide link with 77; mutation to A: Increases sensitivity to alkaline pH and can only function fully at acidic pH (pH < 5).
7aaqA Sugar/h+ symporter stp10 in outward occluded conformation (see paper)
29% identity, 96% coverage: 18:464/466 of query aligns to 11:465/487 of 7aaqA
7aarA Sugar/h+ symporter stp10 in inward open conformation (see paper)
29% identity, 96% coverage: 18:464/466 of query aligns to 16:470/485 of 7aarA
- binding Octyl Glucose Neopentyl Glycol : L28 (vs. gap), I90 (≠ L72), H94 (≠ I76), V98 (≠ N80), F101 (≠ I83), N138 (≠ S120), P142 (= P124), N158 (≠ T140), F161 (≠ Q143), Q162 (= Q144), I165 (= I147), D210 (≠ E202), G391 (= G384), P392 (= P385), W395 (= W388), M419 (≠ W412)
- binding beta-D-glucopyranose: Q280 (= Q272), N286 (= N278), M289 (≠ F281), G391 (= G384), W395 (= W388)
P32037 Solute carrier family 2, facilitated glucose transporter member 3; Glucose transporter type 3, brain; GLUT-3 from Mus musculus (Mouse) (see paper)
30% identity, 99% coverage: 3:464/466 of query aligns to 2:461/493 of P32037
- N43 (≠ A43) modified: carbohydrate, N-linked (GlcNAc...) asparagine
O74969 High-affinity glucose transporter ght2; Hexose transporter 2 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
28% identity, 98% coverage: 8:465/466 of query aligns to 8:468/531 of O74969
Sites not aligning to the query:
- 507 modified: Phosphoserine
- 515 modified: Phosphoserine
- 519 modified: Phosphoserine
- 520 modified: Phosphoserine
- 523 modified: Phosphotyrosine
P78831 High-affinity glucose transporter ght5; Hexose transporter 5 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
26% identity, 98% coverage: 11:465/466 of query aligns to 5:464/546 of P78831
Sites not aligning to the query:
- 528 modified: Phosphoserine
- 537 modified: Phosphoserine
P11166 Solute carrier family 2, facilitated glucose transporter member 1; Glucose transporter type 1, erythrocyte/brain; GLUT-1; HepG2 glucose transporter from Homo sapiens (Human) (see 23 papers)
29% identity, 100% coverage: 1:464/466 of query aligns to 1:463/492 of P11166
- N34 (= N34) to S: in GLUT1DS1; 55% of wild-type glucose uptake activity; dbSNP:rs80359812
- N45 (≠ A45) modified: carbohydrate, N-linked (GlcNAc...) asparagine; mutation to T: Loss of glycosylation site.
- R51 (vs. gap) to H: in EIG12; uncertain significance; dbSNP:rs201815571
- T60 (= T54) to M: in EIG12; uncertain significance; decreased glucose transport; dbSNP:rs142986731
- M77 (≠ F63) to T: in EIG12; decreased glucose transport; dbSNP:rs1187210267
- G91 (= G77) to D: in GLUT1DS1; significantly decreases the transport of 3-O-methyl-D-glucose; dbSNP:rs80359814
- R126 (= R109) to C: in GLUT1DS1, GLUT1DS2 and DYT9; reduced transporter activity; dbSNP:rs80359818; to H: in GLUT1DS1; significantly decreases the transport of 3-O-methyl-D-glucose and dehydroascorbic acid; 57% of wild-type glucose uptake activity; dbSNP:rs80359816
- G130 (= G113) to S: in GLUT1DS1; 75% of wild-type glucose uptake activity; dbSNP:rs80359819
- T137 (≠ S120) binding
- P149 (= P132) to A: in EIG12; uncertain significance
- R153 (= R136) to C: in GLUT1DS1; 44% of wild-type glucose uptake activity
- L169 (≠ W160) natural variant: Missing (in GLUT1DS1; 48% of wild-type glucose uptake activity; dbSNP:rs80359832)
- I192 (≠ M185) mutation to C: Strongly decreases glucose transport.
- L204 (= L197) mutation to C: Abolishes glucose transport.
- P205 (≠ F198) mutation to C: Abolishes glucose transport.
- R212 (= R205) to C: in GLUT1DS1 and DYT9; dbSNP:rs387907312
- R218 (≠ K210) to S: in EIG12; decreased glucose transport
- R223 (≠ E215) to P: in EIG12; mild phenotype; reduced transporter activity; impaired phosphorylation by PKC; dbSNP:rs397514564; to Q: in EIG12; uncertain significance; no effect on glucose transport; impaired phosphorylation by PKC; dbSNP:rs397514564; to W: in GLUT1DS1; impaired phosphorylation by PKC; dbSNP:rs796053248
- S226 (≠ R218) modified: Phosphoserine; by PKC/PRKCB; mutation to A: Abolishes phosphorylation by PKA, leading to impaired response to TPA.
- R232 (≠ F224) to C: in EIG12; the mutant protein is expressed at the cell surface but has mildly decreased glucose uptake (70%) compared to wild-type; dbSNP:rs387907313
- E243 (= E235) to V: in EIG12; decreased glucose transport
- A275 (= A264) to T: in GLUT1DS2; the mutation decreases glucose transport but does not affect cation permeability; dbSNP:rs121909740
- Q282 (= Q272) binding
- QQLS 282:285 (≠ QQLV 272:275) natural variant: Missing (in GLUT1DS2; accompanied by hemolytic anemia and altered erythrocyte ion concentrations; the mutation decreases glucose transport and causes a cation leak that alteres intracellular concentrations of sodium potassium and calcium)
- G286 (= G276) to D: in SDCHCN; no effect on protein abundance; no effect on localization to the plasma membrane; loss of D-glucose transporter activity; increased cation leakage; dbSNP:rs864309514
- T295 (≠ A285) to M: in GLUT1DS1; 75% of wild-type glucose uptake activity; dbSNP:rs80359823
- V303 (≠ F293) to L: found in a patient with GLUT1 deficiency syndrome; dbSNP:rs1205631854
- G314 (= G306) to S: in GLUT1DS2; the mutation decreases glucose transport but does not affect cation permeability; dbSNP:rs121909739
- S324 (≠ T316) to L: in GLUT1DS2; mild phenotype; reduced transporter activity; dbSNP:rs796053253
- E329 (≠ D321) to Q: in GLUT1DS1; stabilizes the inward-open conformation
- R333 (= R325) to Q: in GLUT1DS1 and GLUT1DS2; dbSNP:rs1553155986; to W: in GLUT1DS1; 43% of wild-type glucose uptake activity; dbSNP:rs80359825
- G340 (= G332) mutation to C: Strongly decreases glucose transport.
- W388 (= W388) binding
- N411 (≠ Q411) Not glycosylated; binding ; to S: in EIG12; decreased glucose transport; dbSNP:rs398123069
- I435 (≠ S436) natural variant: Missing (in SDCHCN; no effect on protein abundance; no effect on localization to the plasma membrane; loss of D-glucose transporter activity; increased cation leakage)
- R458 (≠ V459) to W: in EIG12; decreased glucose transport; dbSNP:rs13306758
Sites not aligning to the query:
- 485 P → L: in GLUT1DS1; creates a dileucine internalization motif that promotes recruitment of clathrin and mislocalization of the protein to endocytic compartments
P11168 Solute carrier family 2, facilitated glucose transporter member 2; Glucose transporter type 2, liver; GLUT-2 from Homo sapiens (Human) (see 6 papers)
30% identity, 88% coverage: 54:464/466 of query aligns to 100:495/524 of P11168
- T110 (≠ I64) to I: in dbSNP:rs5400
- V197 (≠ I148) to I: in NIDDM; abolishes transport activity of the transporter expressed in Xenopus oocytes; dbSNP:rs121909741
- I322 (= I280) mutation to V: Reduced fructose transport.
Sites not aligning to the query:
- 68 P → L: in dbSNP:rs7637863
P17809 Solute carrier family 2, facilitated glucose transporter member 1; Glucose transporter type 1, erythrocyte/brain; GLUT-1; GT1 from Mus musculus (Mouse) (see 3 papers)
29% identity, 100% coverage: 1:464/466 of query aligns to 1:463/492 of P17809
- N45 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
Sites not aligning to the query:
- 485 P→L: Lethality immediately after birth in knockin mice; caused by creation of a dileucine internalization motif that promotes mislocalization of the protein.
5eqiA Human glut1 in complex with cytochalasin b (see paper)
30% identity, 89% coverage: 10:422/466 of query aligns to 2:414/447 of 5eqiA
5eqhA Human glut1 in complex with inhibitor (2~{s})-3-(2-bromophenyl)-2-[2- (4-methoxyphenyl)ethanoylamino]-~{n}-[(1~{s})-1- phenylethyl]propanamide (see paper)
30% identity, 89% coverage: 10:422/466 of query aligns to 2:414/447 of 5eqhA
5eqgA Human glut1 in complex with inhibitor (2~{s})-3-(4-fluorophenyl)-2-[2- (3-hydroxyphenyl)ethanoylamino]-~{n}-[(1~{s})-1- phenylethyl]propanamide (see paper)
30% identity, 89% coverage: 10:422/466 of query aligns to 2:414/447 of 5eqgA
Q9P3U7 Probable high-affinity hexose transporter ght8, mitochondrial; Hexose transporter 8 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
27% identity, 98% coverage: 9:465/466 of query aligns to 1:464/547 of Q9P3U7
Sites not aligning to the query:
- 519 modified: Phosphoserine
- 523 modified: Phosphothreonine
- 526 modified: Phosphothreonine
- 527 modified: Phosphoserine
- 528 modified: Phosphoserine
- 529 modified: Phosphoserine
- 537 modified: Phosphoserine
P38695 Probable glucose transporter HXT5 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
29% identity, 100% coverage: 1:465/466 of query aligns to 75:546/592 of P38695
Sites not aligning to the query:
- 61 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
Query Sequence
>Ga0059261_1891 FitnessBrowser__Korea:Ga0059261_1891
MNGESRANMGLIMAIVAVATIGGLLFGYDSGAVNGTQDGLKSAFALSEGGLGFTVGSLLI
GCFIGAFLAGRLADLIGRRNVMILTAVLFLIGALIQGFSHEQWIFVAARIAGGMAVGAAS
VLSPAYISEVAPANIRGRMTTIQQIMIISGLTAAFVVNYWLAKTAGASTNLFWGGYEAWR
WMYWMQAIPATVFLIALFFIPESPRYLVSKGRNAEATRVLTSLFGAGTATNKLTEIQASF
SDHRPTLRDILDPVKGGVRPIVWAGLLLAVFQQLVGINVIFYYGATLWQLAGFTENDALL
INIVSGFVSIAACFVTVALVDRIGRKPLLLIGSAGMAVALFAMVFAFSRGSLDAQGKLVL
SQQLGIIAVIAANLYVVFFNVSWGPVMWVMLGEMFPNQIRGSALAVCGFAQWFSNYLIAQ
SFPIMAAGLGLAVSYSFYAVCAVISFFLVSKFIHETKGVELEDMQG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory