SitesBLAST
Comparing Ga0059261_1900 FitnessBrowser__Korea:Ga0059261_1900 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
39% identity, 98% coverage: 6:249/250 of query aligns to 5:246/246 of 3osuA
1g6kA Crystal structure of glucose dehydrogenase mutant e96a complexed with NAD+
37% identity, 98% coverage: 3:247/250 of query aligns to 2:250/261 of 1g6kA
- active site: G18 (≠ D16), S145 (= S142), Y158 (= Y156), K162 (= K160)
- binding nicotinamide-adenine-dinucleotide: T17 (≠ R15), G18 (≠ D16), L19 (≠ I17), R39 (= R37), D65 (= D63), V66 (= V64), N92 (≠ C91), A93 (= A92), G94 (= G94), M143 (≠ I140), S145 (= S142), Y158 (= Y156), P188 (= P186), G189 (= G187), I191 (= I189), T193 (= T191)
P40288 Glucose 1-dehydrogenase; EC 1.1.1.47 from Priestia megaterium (Bacillus megaterium) (see 2 papers)
37% identity, 98% coverage: 3:247/250 of query aligns to 2:250/261 of P40288
- 11:35 (vs. 9:33, 48% identical) binding
- E96 (≠ V96) mutation E->A,G,K: Heat stable.
- D108 (≠ F108) mutation to N: Heat stable.
- V112 (= V112) mutation to A: Heat stable.
- E133 (vs. gap) mutation to K: Heat stable.
- V183 (= V181) mutation to I: Heat stable.
- P194 (≠ S192) mutation to Q: Heat stable.
- E210 (≠ A207) mutation to K: Heat stable.
- Y217 (≠ R214) mutation to H: Heat stable.
Sites not aligning to the query:
- 252 Q→L: Heat stable.
- 253 Y→C: Heat stable.
- 258 A→G: Heat stable.
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
38% identity, 98% coverage: 6:249/250 of query aligns to 2:239/239 of 3sj7A
- active site: G12 (≠ D16), S138 (= S142), Q148 (≠ A153), Y151 (= Y156), K155 (= K160)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G12), S10 (≠ G14), R11 (= R15), I13 (= I17), N31 (= N35), Y32 (= Y36), A33 (≠ R37), G34 (≠ S38), S35 (≠ D39), A58 (= A62), N59 (≠ D63), V60 (= V64), N86 (≠ C91), A87 (= A92), T109 (≠ L115), S138 (= S142), Y151 (= Y156), K155 (= K160), P181 (= P186), G182 (= G187)
7v0hG Crystal structure of putative glucose 1-dehydrogenase from burkholderia cenocepacia in complex with NADP and a potential reaction product
40% identity, 98% coverage: 2:247/250 of query aligns to 8:252/253 of 7v0hG
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G12), S20 (≠ G14), K21 (≠ R15), G22 (≠ D16), I23 (= I17), A43 (≠ R37), S44 (= S38), S45 (≠ D39), G68 (≠ A62), D69 (= D63), V70 (= V64), N96 (≠ C91), S97 (≠ A92), G98 (= G94), Y100 (≠ V96), I144 (= I140), S146 (= S142), Y159 (= Y156), K163 (= K160), P189 (= P186), G190 (= G187), M191 (≠ L188), I192 (= I189), T194 (vs. gap), G196 (= G190), T197 (= T191)
- binding (2R)-2-(hydroxymethyl)pentanedioic acid: S146 (= S142), Y159 (= Y156), M191 (≠ L188), I202 (= I196)
7nm8AAA Antimycin pathway standalone ketoreductase, AntM (see paper)
39% identity, 99% coverage: 1:247/250 of query aligns to 2:248/251 of 7nm8AAA
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G13 (= G12), S15 (≠ G14), R16 (= R15), G17 (≠ D16), I18 (= I17), H36 (≠ N35), Y37 (= Y36), G38 (≠ R37), H39 (≠ S38), L65 (≠ V64), N97 (≠ C91), G99 (= G93), S147 (= S142), Y160 (= Y156), K164 (= K160), G191 (= G187), T193 (≠ I189), T195 (= T191)
4tkmB Crystal structure of nadh-dependent reductase a1-r' complexed with nad (see paper)
38% identity, 98% coverage: 3:246/250 of query aligns to 5:237/241 of 4tkmB
- active site: G18 (≠ D16), S150 (= S142), Y164 (= Y156), K168 (= K160)
- binding nicotinamide-adenine-dinucleotide: G14 (= G12), T16 (≠ G14), E17 (≠ R15), I19 (= I17), S38 (≠ Y36), H39 (≠ R37), I66 (≠ V64), N92 (≠ C91), G94 (= G93), T148 (≠ I140), S150 (= S142), Y164 (= Y156), K168 (= K160), G195 (= G187), T196 (≠ V206)
7yb2D Crystal structure of anthrol reductase (cbar) in complex with NADP+ and emodin (see paper)
35% identity, 98% coverage: 2:246/250 of query aligns to 9:262/264 of 7yb2D
- binding 3-methyl-1,6,8-trihydroxyanthraquinone: S147 (= S142), Y161 (= Y156), G193 (= G187), M198 (≠ S192), F199 (= F193), V202 (≠ I196), S203 (≠ F197), Y206 (vs. gap)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G12), R22 (= R15), G23 (≠ D16), I24 (= I17), Y43 (= Y36), A44 (≠ R37), N45 (≠ S38), S46 (≠ D39), D70 (= D63), V71 (= V64), N97 (≠ C91), S98 (≠ A92), L120 (= L115), T145 (≠ I140), S147 (= S142), Y161 (= Y156), K165 (= K160), P191 (= P186), G192 (vs. gap), T194 (≠ L188), T196 (≠ G190), M198 (≠ S192)
8hfjC Crystal structure of cbar mutant (h162f) in complex with NADP+ and a bulky 1,3-cyclodiketone (see paper)
35% identity, 98% coverage: 2:246/250 of query aligns to 5:258/260 of 8hfjC
- binding 2-methyl-2-[(4-methylphenyl)methyl]cyclopentane-1,3-dione: N144 (≠ Q143), T145 (≠ A144), F154 (≠ A153), G189 (= G187), V198 (≠ I196)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G12), R18 (= R15), I20 (= I17), Y39 (= Y36), A40 (≠ R37), N41 (≠ S38), S42 (≠ D39), D66 (= D63), V67 (= V64), N93 (≠ C91), S94 (≠ A92), L116 (= L115), T141 (≠ I140), Y157 (= Y156), K161 (= K160), P187 (= P186), T190 (≠ L188), T192 (≠ G190), M194 (≠ S192)
Sites not aligning to the query:
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
39% identity, 100% coverage: 1:249/250 of query aligns to 1:247/247 of 4jroC
- active site: G16 (≠ D16), S142 (= S142), Q152 (≠ A153), Y155 (= Y156), K159 (= K160)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G12), S14 (≠ G14), R15 (= R15), G16 (≠ D16), I17 (= I17), N35 (= N35), Y36 (= Y36), N37 (≠ R37), G38 (≠ S38), S39 (≠ D39), N63 (≠ D63), V64 (= V64), N90 (≠ C91), A91 (= A92), I93 (≠ M95), I113 (≠ L115), S142 (= S142), Y155 (= Y156), K159 (= K160), P185 (= P186), I188 (= I189), T190 (= T191)
8hfkA Crystal structure of cbar mutant (h162f) in complex with NADP+ and halogenated aryl ketone (see paper)
35% identity, 98% coverage: 2:246/250 of query aligns to 5:257/259 of 8hfkA
- binding 2-bromanyl-1-(4-bromanyl-2-oxidanyl-phenyl)ethanone: S143 (= S142), N144 (≠ Q143), T145 (≠ A144), F153 (≠ A153), Y156 (= Y156), G187 (vs. gap), M193 (≠ S192), V197 (≠ I196)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G12), R18 (= R15), I20 (= I17), A40 (≠ R37), N41 (≠ S38), S42 (≠ D39), D66 (= D63), N93 (≠ C91), S94 (≠ A92), L116 (= L115), T141 (≠ I140), Y156 (= Y156), K160 (= K160), P186 (= P186), G187 (vs. gap), G188 (= G187), T189 (≠ L188), T191 (≠ G190), M193 (≠ S192)
Sites not aligning to the query:
3ay6B Crystal structure of bacillus megaterium glucose dehydrogenase 4 a258f mutant in complex with nadh and d-glucose (see paper)
37% identity, 98% coverage: 3:247/250 of query aligns to 11:256/267 of 3ay6B
- active site: G24 (≠ D16), S151 (≠ G145), Y164 (= Y156), K168 (= K160)
- binding beta-D-glucopyranose: E102 (vs. gap), S151 (≠ G145), H153 (≠ D147), W158 (≠ G152), Y164 (= Y156), N202 (≠ H194), K205 (≠ I196)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G20 (= G12), T23 (≠ R15), G24 (≠ D16), L25 (≠ I17), Y45 (≠ R37), D71 (= D63), V72 (= V64), N98 (≠ C91), A99 (= A92), G100 (= G93), V101 (vs. gap), M149 (≠ Q143), S151 (≠ G145), Y164 (= Y156), K168 (= K160), P194 (= P186), G195 (= G187), M197 (≠ I189), T199 (= T191), P200 (≠ S192), I201 (≠ F193), N202 (≠ H194)
4i08A Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with NADPH (see paper)
40% identity, 100% coverage: 1:249/250 of query aligns to 4:242/243 of 4i08A
- active site: G19 (≠ D16), N113 (= N116), S141 (= S142), Q151 (≠ A153), Y154 (= Y156), K158 (= K160)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G12), S17 (≠ G14), R18 (= R15), I20 (= I17), T40 (≠ S38), N62 (≠ D63), V63 (= V64), N89 (≠ C91), A90 (= A92), G140 (≠ A141), S141 (= S142), Y154 (= Y156), K158 (= K160), P184 (= P186), G185 (= G187), T189 (= T191)
8bcjB Crystal structure of short-chain dehydrogenase pa3128 from pseudomonas aeruginosa pao1 in complex with NADP+
39% identity, 96% coverage: 6:246/250 of query aligns to 5:249/250 of 8bcjB
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G12), S13 (≠ G14), R14 (= R15), G15 (≠ D16), I16 (= I17), L36 (≠ R37), R37 (≠ S38), N38 (≠ D39), A61 (= A62), D62 (= D63), V63 (= V64), N89 (≠ C91), A90 (= A92), G91 (= G93), T113 (≠ L115), V143 (≠ I140), S145 (= S142), Y159 (= Y156), K163 (= K160), P189 (= P186), G190 (= G187), I192 (= I189), T194 (= T191), I196 (≠ F193), H197 (= H194)
P73574 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-acyl carrier protein reductase; EC 1.1.1.100 from Synechocystis sp. (strain PCC 6803 / Kazusa) (see paper)
41% identity, 97% coverage: 6:247/250 of query aligns to 7:244/247 of P73574
- A14 (≠ G13) mutation to G: 4.2-fold increase in activity on acetoacetyl-CoA.
- P151 (= P151) mutation to F: 2.7-fold increase in activity on acetoacetyl-CoA.; mutation to V: 5.7-fold increase in activity on acetoacetyl-CoA.
- K160 (= K160) mutation to A: Almost no activity on acetoacetyl-CoA.
- F188 (≠ L188) mutation to Y: 3.3-fold increase in activity on acetoacetyl-CoA.
- N198 (≠ F197) mutation to R: 3.5-fold increase in activity on acetoacetyl-CoA.
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
40% identity, 100% coverage: 1:249/250 of query aligns to 4:246/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G12), S17 (≠ G14), R18 (= R15), I20 (= I17), T40 (≠ S38), N62 (≠ D63), V63 (= V64), N89 (≠ C91), A90 (= A92), I92 (≠ M95), V139 (≠ I140), S141 (= S142), Y154 (= Y156), K158 (= K160), P184 (= P186), G185 (= G187), I187 (= I189), T189 (= T191), M191 (≠ F193)
Q9KJF1 (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD; (S,R)-2-(alpha-hydroxybenzyl)succinyl-CoA dehydrogenase subunit BbsD; EC 1.1.1.429 from Thauera aromatica (see 2 papers)
39% identity, 98% coverage: 1:246/250 of query aligns to 1:242/248 of Q9KJF1
- M1 (= M1) modified: Initiator methionine, Removed
- S15 (≠ R15) binding
- D36 (≠ R37) binding
- D62 (= D63) binding
- I63 (≠ V64) binding
- N89 (≠ C91) binding
- Y153 (= Y156) binding
- K157 (= K160) binding
7pcsB Structure of the heterotetrameric sdr family member bbscd (see paper)
39% identity, 98% coverage: 3:246/250 of query aligns to 2:241/247 of 7pcsB
- binding nicotinamide-adenine-dinucleotide: G11 (= G12), M16 (≠ I17), D35 (≠ R37), I36 (≠ S38), I62 (≠ V64), N88 (≠ C91), G90 (= G93), I138 (= I140), S140 (= S142), Y152 (= Y156), K156 (= K160), I185 (= I189)
4cqlI Crystal structure of heterotetrameric human ketoacyl reductase complexed with NAD (see paper)
37% identity, 99% coverage: 2:249/250 of query aligns to 5:251/251 of 4cqlI
- active site: G19 (≠ D16), S146 (= S142), Y159 (= Y156), K163 (= K160)
- binding nicotinamide-adenine-dinucleotide: S18 (≠ R15), G19 (≠ D16), I20 (= I17), D39 (≠ R37), L40 (≠ S38), A64 (= A62), D65 (= D63), V66 (= V64), C93 (= C91), A94 (= A92), G95 (= G93), I96 (≠ M95), V116 (≠ L115), I144 (= I140), S146 (= S142), Y159 (= Y156), K163 (= K160), P189 (= P186), G190 (= G187), I192 (= I189), T194 (= T191), M196 (≠ F193)
4fj1B Crystal structure of the ternary complex between a fungal 17beta- hydroxysteroid dehydrogenase (holo form) and genistein (see paper)
34% identity, 98% coverage: 2:246/250 of query aligns to 4:257/259 of 4fj1B
- active site: G18 (≠ D16), S142 (= S142), N143 (≠ Q143), H153 (≠ A153), Y156 (= Y156), K160 (= K160), Y201 (vs. gap)
- binding genistein: G188 (= G187), F194 (= F193), S198 (vs. gap), Y201 (vs. gap), I202 (vs. gap), M216 (≠ A205), A217 (≠ V206)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G12), R17 (= R15), G18 (≠ D16), I19 (= I17), A39 (≠ R37), N40 (≠ S38), S41 (≠ D39), I66 (≠ V64), N92 (≠ C91), S93 (≠ A92), G94 (= G94), L115 (= L115), T140 (≠ I140), S142 (= S142), Y156 (= Y156), K160 (= K160), G187 (vs. gap), T189 (≠ L188), T191 (≠ G190), M193 (≠ S192)
Query Sequence
>Ga0059261_1900 FitnessBrowser__Korea:Ga0059261_1900
MRFKDKVAIVTGGGRDIGKSISLRLAAEGAKVVINYRSDEAAAKATLDAIEAAGGTALLA
RADVTKADEVVALVKAATDAFGGKVDILVNCAGGMVARKTLAEMDEAFFDTVMDLNLKSA
FLVTKAVLPHLESGAAIVNIASQAGRDGGGPGASIYAASKGALMTLTRSWAKELGPQGIR
VNALNPGLIGTSFHDIFSKPEGRAAVAGNTPLRREGHPDEVAAAVAFLASGDASFLTGTN
VDINGGLFFS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory