Comparing Ga0059261_1905 FitnessBrowser__Korea:Ga0059261_1905 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 16 hits to proteins with known functional sites (download)
3p47A Crystal structure of entamoeba histolytica serine acetyltransferase 1 in complex with l-cysteine (see paper)
37% identity, 83% coverage: 42:298/308 of query aligns to 30:270/270 of 3p47A
3q1xA Crystal structure of entamoeba histolytica serine acetyltransferase 1 in complex with l-serine (see paper)
37% identity, 83% coverage: 42:296/308 of query aligns to 28:266/267 of 3q1xA
7bw9A Crystal structure of serine acetyltransferase isoform 3 in complex with cysteine from entamoeba histolytica
42% identity, 62% coverage: 115:305/308 of query aligns to 86:270/280 of 7bw9A
6wyeA Crystal structure of neisseria gonorrhoeae serine acetyltransferase (cyse) (see paper)
39% identity, 56% coverage: 128:300/308 of query aligns to 78:242/261 of 6wyeA
7ra4A Crystal structure of neisseria gonorrhoeae serine acetyltransferase (cyse) in complex with serine (see paper)
39% identity, 56% coverage: 128:300/308 of query aligns to 76:240/243 of 7ra4A
4n69A Soybean serine acetyltransferase complexed with serine (see paper)
35% identity, 74% coverage: 72:300/308 of query aligns to 20:240/243 of 4n69A
4hzdA Crystal structure of serine acetyltransferase in complex with coenzyme a from brucella abortus strain s19 (see paper)
39% identity, 56% coverage: 123:296/308 of query aligns to 72:236/250 of 4hzdA
Sites not aligning to the query:
4h7oA Crystal structure of serine acetyltransferase from vibrio cholerae o1 biovar el tor n16961
37% identity, 61% coverage: 113:300/308 of query aligns to 58:237/258 of 4h7oA
Sites not aligning to the query:
1ssqD Serine acetyltransferase- complex with cysteine (see paper)
35% identity, 64% coverage: 96:292/308 of query aligns to 45:228/257 of 1ssqD
4n6bA Soybean serine acetyltransferase complexed with coa (see paper)
34% identity, 74% coverage: 72:300/308 of query aligns to 16:230/233 of 4n6bA
8i09A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with butyl gallate (see paper)
40% identity, 54% coverage: 135:300/308 of query aligns to 83:240/246 of 8i09A
8i06A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with coa (see paper)
40% identity, 54% coverage: 135:300/308 of query aligns to 84:241/244 of 8i06A
8i04A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with serine (see paper)
40% identity, 54% coverage: 135:300/308 of query aligns to 80:237/258 of 8i04A
1t3dA Crystal structure of serine acetyltransferase from e.Coli at 2.2a (see paper)
38% identity, 54% coverage: 135:300/308 of query aligns to 84:241/262 of 1t3dA
1sstA Serine acetyltransferase- complex with coa (see paper)
34% identity, 63% coverage: 99:292/308 of query aligns to 48:221/233 of 1sstA
Sites not aligning to the query:
3gvdI Crystal structure of serine acetyltransferase cyse from yersinia pestis
39% identity, 51% coverage: 135:291/308 of query aligns to 87:234/272 of 3gvdI
>Ga0059261_1905 FitnessBrowser__Korea:Ga0059261_1905
MGRQQAMVEIYPRNLERLVAGLRDARCEWRQGHDRHAEQGIEFPSRRVLARLLRELGTAL
FPLRLGPPELTASNENAWVEATLESTLSQLGAQIELELRIARPGISRIEEGYAVEHILTD
FAESLPGIRRLLDEDVAAGYANDPAARSVDEVLLSYPSIAAIIHHRLAHRLHALGAPLVA
RVIAEVAHGETGIDIHPAARIGRSFFIDHGTGIVIGETAVIGDRVRIYQGVTLGGEPIPA
GAAHRGDTRTRRHPRIGDDVVIFPGAVLLGPIDVGARSRIGGNVWLRDDVPEDSLVELPA
LRTRQLGD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory