Comparing Ga0059261_1999 FitnessBrowser__Korea:Ga0059261_1999 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
4f4fA X-ray crystal structure of plp bound threonine synthase from brucella melitensis
54% identity, 99% coverage: 1:463/466 of query aligns to 2:463/464 of 4f4fA
1kl7A Crystal structure of threonine synthase from yeast (see paper)
42% identity, 90% coverage: 3:423/466 of query aligns to 7:459/509 of 1kl7A
Q42598 Threonine synthase; TS; EC 4.2.3.1 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
41% identity, 97% coverage: 1:454/466 of query aligns to 5:483/514 of Q42598
8g1yA Crystal structure of the threonine synthase from streptococcus pneumoniae in complex with pyridoxal 5-phosphate.
39% identity, 91% coverage: 1:425/466 of query aligns to 5:442/496 of 8g1yA
1vb3A Crystal structure of threonine synthase from escherichia coli
30% identity, 97% coverage: 1:454/466 of query aligns to 1:420/428 of 1vb3A
6nmxA Threonine synthase from bacillus subtilis atcc 6633 with plp and appa (see paper)
30% identity, 38% coverage: 85:262/466 of query aligns to 26:193/350 of 6nmxA
Sites not aligning to the query:
6cgqA Threonine synthase from bacillus subtilis atcc 6633 with plp and plp- ala (see paper)
30% identity, 38% coverage: 85:262/466 of query aligns to 22:183/339 of 6cgqA
Sites not aligning to the query:
6cgqB Threonine synthase from bacillus subtilis atcc 6633 with plp and plp- ala (see paper)
30% identity, 38% coverage: 85:262/466 of query aligns to 24:191/345 of 6cgqB
Sites not aligning to the query:
>Ga0059261_1999 FitnessBrowser__Korea:Ga0059261_1999
MRYQSTRGTAPELDFRDVTLAGLAKDGGLYVPVEWPRFTPEQIADLAGLSYVETAVRVMA
PFTAGSLSEAELRELCTAAYGRFSHDAVTPLVQLDHRHFLLELFHGPTLAFKDVALQLLG
LFFERFLKGTDQHLTIVGATSGDTGSAAIDAVAGREGIDIFMLHPNKRVSDVQRRQMTTV
LSPNVHNIAIEGSFDDAQAMVKAMFNDAGFAGRFQVTAVNSINWARLMAQVVYYFYAAVR
LGAPNRAVAFSVPTGNFGDVFAGYVAARMGLPVAKLIVATNVNDILHRALSAGDYSTGTV
TPTAAPSMDIQVSSNFERLLFDLAGRDGAALADQMRGFEASKAMRLTNAQQEGAAKLFAS
DRIDAAEMAQAMAWAHARADEILDPHTAIGLAAARRADIATDVPIVTLATAHPAKFGDAV
ERATGIRPTLPARIGDLFDREERYDVLPATFDAVTGYIAERAKPRS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory