Comparing Ga0059261_2015 FitnessBrowser__Korea:Ga0059261_2015 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2v6kA Structure of maleyl pyruvate isomerase, a bacterial glutathione-s- transferase in zeta class, in complex with substrate analogue dicarboxyethyl glutathione (see paper)
48% identity, 99% coverage: 1:205/208 of query aligns to 3:214/214 of 2v6kA
2jl4A Holo structure of maleyl pyruvate isomerase, a bacterial glutathione- s-transferase in zeta class (see paper)
48% identity, 99% coverage: 1:205/208 of query aligns to 1:212/212 of 2jl4A
O86043 Maleylpyruvate isomerase; MPI; Naphthalene degradation protein L; EC 5.2.1.4 from Ralstonia sp. (see paper)
48% identity, 99% coverage: 1:205/208 of query aligns to 1:212/212 of O86043
4kdyA Crystal structure of maleylacetoacetate isomerase from anaeromyxobacter dehalogenans 2cp-1, target efi-507175, with bound gsh in the active site
47% identity, 97% coverage: 3:204/208 of query aligns to 12:210/222 of 4kdyA
4kaeA Crystal structure of maleylacetoacetate isomerase from anaeromyxobacter dehalogenans 2cp-1, target efi-507175, with bound dicarboxyethyl glutathione and citrate in the active site
47% identity, 97% coverage: 3:204/208 of query aligns to 10:208/220 of 4kaeA
Q9WVL0 Maleylacetoacetate isomerase; MAAI; GSTZ1-1; Glutathione S-transferase zeta 1; EC 5.2.1.2; EC 2.5.1.18 from Mus musculus (Mouse)
42% identity, 98% coverage: 2:204/208 of query aligns to 7:206/216 of Q9WVL0
2cz2A Crystal structure of glutathione transferase zeta 1-1 (maleylacetoacetate isomerase) from mus musculus (form-1 crystal)
42% identity, 98% coverage: 2:204/208 of query aligns to 4:203/212 of 2cz2A
O43708 Maleylacetoacetate isomerase; MAAI; GSTZ1-1; Glutathione S-transferase zeta 1; EC 5.2.1.2; EC 2.5.1.18 from Homo sapiens (Human) (see 10 papers)
40% identity, 98% coverage: 2:204/208 of query aligns to 7:206/216 of O43708
1fw1A Glutathione transferase zeta/maleylacetoacetate isomerase (see paper)
40% identity, 98% coverage: 2:204/208 of query aligns to 3:202/208 of 1fw1A
4pxoA Crystal structure of maleylacetoacetate isomerase from methylobacteriu extorquens am1 with bound malonate and gsh (target efi-507068)
38% identity, 97% coverage: 3:204/208 of query aligns to 5:210/216 of 4pxoA
3n5oA Crystal structure of putative glutathione transferase from coccidioides immitis bound to glutathione (see paper)
35% identity, 87% coverage: 3:182/208 of query aligns to 6:197/228 of 3n5oA
D2YW48 Probable glutathione S-transferase; EC 2.5.1.18 from Coccidioides immitis (strain RS) (Valley fever fungus)
35% identity, 87% coverage: 3:182/208 of query aligns to 8:199/231 of D2YW48
Q8L7C9 Glutathione S-transferase U20; AtGSTU20; FIN219-interacting protein 1; GST class-tau member 20; EC 2.5.1.18 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
31% identity, 79% coverage: 2:165/208 of query aligns to 6:158/217 of Q8L7C9
5echB Crystal structure of fin219-fip1 complex with ja and atp (see paper)
31% identity, 79% coverage: 2:165/208 of query aligns to 3:155/214 of 5echB
3m3mA Crystal structure of glutathione s-transferase from pseudomonas fluorescens [pf-5]
24% identity, 88% coverage: 3:186/208 of query aligns to 5:185/201 of 3m3mA
4topA Glycine max glutathione transferase
30% identity, 80% coverage: 1:166/208 of query aligns to 4:158/218 of 4topA
3ibhA Crystal structure of saccharomyces cerevisiae gtt2 in complex with glutathione (see paper)
34% identity, 44% coverage: 1:91/208 of query aligns to 1:93/208 of 3ibhA
Sites not aligning to the query:
3ergA Crystal structure of gtt2 from saccharomyces cerevisiae in complex with glutathione sulfnate (see paper)
34% identity, 44% coverage: 1:91/208 of query aligns to 1:93/208 of 3ergA
Sites not aligning to the query:
Q12390 Glutathione S-transferase 2; GST-II; EC 2.5.1.18 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
34% identity, 44% coverage: 1:91/208 of query aligns to 19:111/233 of Q12390
Sites not aligning to the query:
2imkA Structures of an insect epsilon-class glutathione s-transferase from the malaria vector anopheles gambiae: evidence for high ddt- detoxifying activity (see paper)
35% identity, 44% coverage: 1:91/208 of query aligns to 3:93/220 of 2imkA
Sites not aligning to the query:
>Ga0059261_2015 FitnessBrowser__Korea:Ga0059261_2015
MILYDYFRSSAAYRVRIALNLKGVEAERREVHLVKGEQRSPEHVARNPQGFVPALDIGNG
HILTQSLAIIEWLDSVYPEPRLIPADPLARADAMARALTIAADTHPVNNLRILKRLETQF
GADEAAKGEWYRHWIAEGFAALEAMAGSGPFLGGGAPDVSDVLLVPQMYNARRFELPLDP
YPRLVAADAAASALAPFAAAHPDRAKPE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory