Comparing Ga0059261_2051 FitnessBrowser__Korea:Ga0059261_2051 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4xg1B Psychromonas ingrahamii diaminopimelate decarboxylase with llp
43% identity, 99% coverage: 2:414/419 of query aligns to 1:415/418 of 4xg1B
4xg1A Psychromonas ingrahamii diaminopimelate decarboxylase with llp
39% identity, 99% coverage: 2:414/419 of query aligns to 1:390/393 of 4xg1A
B4XMC6 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Helicobacter pylori (Campylobacter pylori) (see paper)
38% identity, 90% coverage: 27:402/419 of query aligns to 13:388/405 of B4XMC6
1twiA Crystal structure of diaminopimelate decarboxylase from m. Jannaschii in co-complex with l-lysine (see paper)
35% identity, 99% coverage: 2:415/419 of query aligns to 5:430/434 of 1twiA
Q58497 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
35% identity, 98% coverage: 7:415/419 of query aligns to 14:434/438 of Q58497
1tufA Crystal structure of diaminopimelate decarboxylase from m. Jannaschi (see paper)
35% identity, 98% coverage: 7:415/419 of query aligns to 10:430/434 of 1tufA
3c5qA Crystal structure of diaminopimelate decarboxylase (i148l mutant) from helicobacter pylori complexed with l-lysine
38% identity, 90% coverage: 27:402/419 of query aligns to 11:380/394 of 3c5qA
Q9X1K5 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
36% identity, 90% coverage: 26:402/419 of query aligns to 12:374/386 of Q9X1K5
2yxxA Crystal structure analysis of diaminopimelate decarboxylate (lysa)
36% identity, 90% coverage: 26:402/419 of query aligns to 11:373/385 of 2yxxA
6n2aA Meso-diaminopimelate decarboxylase from arabidopsis thaliana (isoform 1)
34% identity, 94% coverage: 1:394/419 of query aligns to 1:400/422 of 6n2aA
P00861 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Escherichia coli (strain K12)
35% identity, 94% coverage: 11:402/419 of query aligns to 12:408/420 of P00861
1ko0A Crystal structure of a d,l-lysine complex of diaminopimelate decarboxylase
35% identity, 94% coverage: 11:402/419 of query aligns to 11:407/419 of 1ko0A
1knwA Crystal structure of diaminopimelate decarboxylase
35% identity, 94% coverage: 11:402/419 of query aligns to 11:407/421 of 1knwA
7ru7A Crystal structure of btrk, a decarboxylase involved in butirosin biosynthesis
29% identity, 88% coverage: 11:377/419 of query aligns to 1:374/412 of 7ru7A
8d5rA Structure of y430f d-ornithine/d-lysine decarboxylase complex with d- ornithine (see paper)
28% identity, 93% coverage: 4:394/419 of query aligns to 23:436/461 of 8d5rA
8d5dA Structure of y430f d-ornithine/d-lysine decarboxylase complex with d- arginine (see paper)
28% identity, 93% coverage: 4:394/419 of query aligns to 22:434/458 of 8d5dA
8d88A Structure of y430f d-ornithine/d-lysine decarboxylase complex with d- lysine (see paper)
28% identity, 93% coverage: 4:394/419 of query aligns to 23:438/461 of 8d88A
5x7nA Crystal structure of meso-diaminopimelate decarboxylase (dapdc) from corynebacterium glutamicum (see paper)
30% identity, 90% coverage: 6:382/419 of query aligns to 20:412/442 of 5x7nA
5x7mA Crystal structure of meso-diaminopimelate decarboxylase (dapdc) from corynebacterium glutamicum (see paper)
30% identity, 90% coverage: 6:382/419 of query aligns to 20:412/443 of 5x7mA
8d4iA Structure of y430f d-ornithine/d-lysine decarboxylase complex with putrescine (see paper)
28% identity, 93% coverage: 4:394/419 of query aligns to 23:438/462 of 8d4iA
>Ga0059261_2051 FitnessBrowser__Korea:Ga0059261_2051
MDHFNRKNGVLHAENVSIPAIAAEVGTPVYVYSTATLERHASALKNALAGLPSVHLAFAI
KANPNLAVLGVLARQGYGADVVSGGELKRALAAGMPAEDVVFSGVGKTRAELQLGLDEGI
GQFNLELEEEGEVLADLAHAQGKTAPAVLRVNPDVDAGTHAKISTGKAENKFGVAIDRAL
EIFDRLAKRPGLNLRGVAIHIGSQLTELAPLEAAYKRVGELVAQLRAAGHTITHVDLGGG
LGVPYHAGQTVSTAEEFGAMVARVTQGWNVTLMFEPGRFICGNAGVLVTEVIWVKPAAGN
PYVIVDAAMNDLARPALYDAYHEFEAVEPTGEKFVANIAGPVCETGDTFAMGREIDVVKS
GDLAVFRTAGAYGATMASTYNSRALVPEVLVSGDRFAVVADRIQPETIMGAERVPEWVR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory