SitesBLAST
Comparing Ga0059261_2135 FitnessBrowser__Korea:Ga0059261_2135 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1uufA Crystal structure of a zinc-type alcohol dehydrogenase-like protein yahk
67% identity, 97% coverage: 6:351/355 of query aligns to 2:338/339 of 1uufA
- active site: C38 (= C42), H39 (= H43), S40 (= S44), H43 (= H47), H60 (= H64), E61 (= E65), C91 (= C95), C94 (= C98), C97 (= C101), C105 (= C109), T109 (≠ V115), C156 (= C162), T160 (= T166), R330 (= R343)
- binding zinc ion: C38 (= C42), H60 (= H64), C91 (= C95), C94 (= C98), C97 (= C101), C105 (= C109), C156 (= C162)
Sites not aligning to the query:
P0CH37 NADP-dependent alcohol dehydrogenase C 2; Ms-ADHC 2; EC 1.1.1.2 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
54% identity, 98% coverage: 3:351/355 of query aligns to 2:347/349 of P0CH37
- K210 (≠ G213) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
P0CH36 NADP-dependent alcohol dehydrogenase C 1; Ms-ADHC 1; EC 1.1.1.2 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
54% identity, 98% coverage: 3:351/355 of query aligns to 2:347/349 of P0CH36
- K210 (≠ G213) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
P9WQC5 NADP-dependent alcohol dehydrogenase C; EC 1.1.1.2 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
53% identity, 98% coverage: 3:351/355 of query aligns to 2:346/346 of P9WQC5
- K209 (≠ G213) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
5z0cA Nerol dehydrogenase from persicaria minor (see paper)
47% identity, 97% coverage: 5:350/355 of query aligns to 7:349/367 of 5z0cA
- active site: C44 (= C42), S46 (= S44), H49 (= H47), H66 (= H64), C160 (= C162)
- binding zinc ion: C44 (= C42), H66 (= H64), C97 (= C95), C100 (= C98), C103 (= C101), C111 (= C109), C160 (= C162)
1yqdA Sinapyl alcohol dehydrogenase complexed with NADP+ (see paper)
46% identity, 99% coverage: 2:353/355 of query aligns to 7:355/359 of 1yqdA
- active site: C47 (= C42), H48 (= H43), S49 (= S44), H52 (= H47), H69 (= H64), E70 (= E65), C100 (= C95), C103 (= C98), C106 (= C101), C114 (= C109), I118 (≠ V115), C163 (= C162), T167 (= T166), R345 (= R343)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: C47 (= C42), H48 (= H43), S49 (= S44), H52 (= H47), C163 (= C162), T167 (= T166), G188 (= G186), L189 (≠ I187), G190 (= G188), G191 (= G189), L192 (= L190), S211 (≠ T209), T212 (= T210), S213 (= S211), K216 (= K214), T251 (= T248), V252 (= V249), S253 (≠ A250), V274 (= V271), G275 (= G272), A276 (≠ V273), G299 (≠ L297), I300 (= I298), N340 (≠ G338), R345 (= R343)
- binding zinc ion: C47 (= C42), H69 (= H64), C100 (= C95), C103 (= C98), C106 (= C101), C114 (= C109), C163 (= C162)
3twoB The crystal structure of cad from helicobacter pylori complexed with NADP(h) (see paper)
44% identity, 99% coverage: 1:350/355 of query aligns to 1:345/348 of 3twoB
- active site: C42 (= C42), H43 (= H43), S44 (= S44), H47 (= H47), H64 (= H64), E65 (= E65), C95 (= C95), C98 (= C98), C101 (= C101), C109 (= C109), V113 (= V115), C160 (= C162), T164 (= T166), R338 (= R343)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: C42 (= C42), H43 (= H43), S44 (= S44), H47 (= H47), C160 (= C162), T164 (= T166), G184 (= G186), F185 (≠ I187), G186 (= G188), G187 (= G189), L188 (= L190), R208 (≠ T210), T241 (= T248), I242 (≠ V249), P243 (≠ A250), T244 (≠ A251), V264 (= V271), G265 (= G272), L266 (≠ V273), L292 (= L297), I293 (= I298), L330 (≠ M335), G333 (= G338), R338 (= R343)
- binding zinc ion: C42 (= C42), H64 (= H64), C95 (= C95), C98 (= C98), C101 (= C101), C109 (= C109), C160 (= C162)
6k3gB Crystal structure of 10-hydroxygeraniol dehydrogenase from cantharanthus roseus in complex with NADP+ (see paper)
47% identity, 98% coverage: 2:350/355 of query aligns to 7:352/356 of 6k3gB
- active site: C47 (= C42), S49 (= S44), H52 (= H47), H69 (= H64), C163 (= C162)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: H48 (= H43), S49 (= S44), H52 (= H47), W58 (= W53), C163 (= C162), T167 (= T166), G188 (= G186), L189 (≠ I187), G190 (= G188), G191 (= G189), L192 (= L190), S211 (≠ T209), T212 (= T210), S213 (= S211), K216 (= K214), T251 (= T248), V252 (= V249), S253 (≠ A250), A254 (= A251), V274 (= V271), G275 (= G272), A276 (≠ V273), A299 (≠ L297), I300 (= I298), R345 (= R343)
- binding zinc ion: C47 (= C42), H69 (= H64), C100 (= C95), C103 (= C98), C106 (= C101), C114 (= C109), C163 (= C162)
5vktA Cinnamyl alcohol dehydrogenases (sbcad4) from sorghum bicolor (l.) Moench (see paper)
47% identity, 97% coverage: 5:349/355 of query aligns to 3:346/353 of 5vktA
- active site: C40 (= C42), H41 (= H43), T42 (≠ S44), H45 (= H47), H62 (= H64), E63 (= E65), C93 (= C95), C96 (= C98), C99 (= C101), C107 (= C109), V111 (= V115), C158 (= C162), T162 (= T166), R340 (= R343)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: C40 (= C42), H41 (= H43), T42 (≠ S44), H45 (= H47), C158 (= C162), T162 (= T166), G183 (= G186), L184 (≠ I187), G185 (= G188), G186 (= G189), L187 (= L190), S206 (≠ T209), S207 (≠ T210), S208 (= S211), K211 (= K214), T246 (= T248), V247 (= V249), S248 (≠ A250), A249 (= A251), V269 (= V271), G270 (= G272), N293 (≠ S296), G294 (≠ L297), N335 (≠ G338), R340 (= R343)
- binding zinc ion: C40 (= C42), H62 (= H64), C93 (= C95), C96 (= C98), C99 (= C101), C107 (= C109), C158 (= C162)
7cguA Crystal structure of abhar
44% identity, 98% coverage: 8:355/355 of query aligns to 7:352/352 of 7cguA
8a3nB Geissoschizine synthase from catharanthus roseus - binary complex with NADP+ (see paper)
40% identity, 97% coverage: 5:350/355 of query aligns to 7:347/352 of 8a3nB
- binding nadp nicotinamide-adenine-dinucleotide phosphate: N45 (≠ H43), V161 (≠ T166), G182 (= G186), L183 (≠ I187), L186 (= L190), S205 (≠ T209), T206 (= T210), K210 (= K214), T245 (= T248), P247 (≠ A250), V269 (= V271), A271 (≠ V273), S294 (≠ L297), L335 (≠ G338), R340 (= R343)
- binding zinc ion: C44 (= C42), H66 (= H64), E67 (= E65), C97 (= C95), C100 (= C98), C103 (= C101), C111 (= C109), C157 (= C162)
5fi3A Heteroyohimbine synthase thas1 from catharanthus roseus - complex with NADP+ (see paper)
38% identity, 98% coverage: 4:350/355 of query aligns to 3:340/344 of 5fi3A
- active site: C43 (= C42), Q44 (≠ H43), Y45 (≠ S44), E48 (≠ H47), H65 (= H64), E66 (= E65), C96 (= C95), C99 (= C98), C102 (= C101), C110 (= C109), G114 (≠ H124), C151 (= C162), R333 (= R343)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: Q44 (≠ H43), E48 (≠ H47), T155 (= T166), G176 (= G186), L177 (≠ I187), G178 (= G188), G179 (= G189), L180 (= L190), S199 (≠ T209), S200 (≠ T210), K204 (= K214), T239 (= T248), I240 (≠ V249), P241 (≠ A250), L262 (≠ V271), G263 (= G272), T287 (≠ L297), S328 (≠ G338)
- binding zinc ion: C43 (= C42), H65 (= H64), E66 (= E65), C96 (= C95), C99 (= C98), C102 (= C101), C110 (= C109), C151 (= C162)
5h81B Heteroyohimbine synthase thas2 from catharanthus roseus - complex with NADP+ (see paper)
39% identity, 98% coverage: 2:350/355 of query aligns to 1:350/354 of 5h81B
- active site: A343 (≠ R343)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V174 (≠ T166), F196 (≠ I187), G197 (= G188), R198 (≠ G189), I199 (≠ L190), S218 (≠ T209), T219 (= T210), S220 (= S211), K223 (= K214), V259 (= V249), P260 (≠ A250), L281 (≠ V271), I297 (≠ L297)
- binding zinc ion: C41 (= C42), H63 (= H64), E64 (= E65), C94 (= C95), C97 (= C98), C100 (= C101), C108 (= C109), C170 (= C162)
O49482 Cinnamyl alcohol dehydrogenase 5; AtCAD5; Cinnamyl alcohol dehydrogenase D; EC 1.1.1.195 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
43% identity, 96% coverage: 8:348/355 of query aligns to 13:350/357 of O49482
- C47 (= C42) binding
- T49 (≠ S44) binding
- H69 (= H64) binding
- E70 (= E65) binding ; mutation to A: Loss of activity.
- C100 (= C95) binding
- C103 (= C98) binding
- C106 (= C101) binding
- C114 (= C109) binding
- C163 (= C162) binding
- T167 (= T166) binding
- GLGGVG 188:193 (≠ GIGGLG 186:191) binding
- SSSNKK 211:216 (≠ TTSEGK 209:214) binding
- T251 (= T248) binding
- G275 (= G272) binding
- SFI 298:300 (≠ SLI 296:298) binding
2cf6A Crystal structures of the arabidopsis cinnamyl alcohol dehydrogenases atcad5 (see paper)
43% identity, 96% coverage: 8:348/355 of query aligns to 8:345/352 of 2cf6A
- active site: C42 (= C42), H43 (= H43), T44 (≠ S44), H47 (= H47), H64 (= H64), E65 (= E65), C95 (= C95), C98 (= C98), C101 (= C101), C109 (= C109), I113 (≠ V115), C158 (= C162), T162 (= T166), R340 (= R343)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: H43 (= H43), T44 (≠ S44), T162 (= T166), L184 (≠ I187), G185 (= G188), G186 (= G189), V187 (≠ L190), S206 (≠ T209), S207 (≠ T210), K211 (= K214), T246 (= T248), M269 (≠ V271), S293 (= S296), F294 (≠ L297), I295 (= I298)
- binding zinc ion: C42 (= C42), H64 (= H64), E65 (= E65), C98 (= C98), C109 (= C109)
2cf5A Crystal structures of the arabidopsis cinnamyl alcohol dehydrogenases, atcad5 (see paper)
43% identity, 96% coverage: 8:348/355 of query aligns to 8:345/352 of 2cf5A
- active site: C42 (= C42), H43 (= H43), T44 (≠ S44), H47 (= H47), H64 (= H64), E65 (= E65), C95 (= C95), C98 (= C98), C101 (= C101), C109 (= C109), I113 (≠ V115), C158 (= C162), T162 (= T166), R340 (= R343)
- binding zinc ion: C42 (= C42), H64 (= H64), E65 (= E65), C95 (= C95), C98 (= C98), C101 (= C101), C109 (= C109), C158 (= C162)
8b1vA Dihydroprecondylocarpine acetate synthase 2 from tabernanthe iboga (see paper)
41% identity, 98% coverage: 4:350/355 of query aligns to 7:353/358 of 8b1vA
8b25B Dihydroprecondylocarpine acetate synthase 2 from tabernanthe iboga - stemmadenine acetate bound structure (see paper)
41% identity, 98% coverage: 4:350/355 of query aligns to 7:353/359 of 8b25B
Q6ZHS4 Cinnamyl alcohol dehydrogenase 2; OsCAD2; Protein GOLD HULL AND INTERNODE 2; EC 1.1.1.195 from Oryza sativa subsp. japonica (Rice) (see paper)
43% identity, 96% coverage: 8:349/355 of query aligns to 13:351/363 of Q6ZHS4
- G185 (= G183) mutation to D: Loss of activity.
5h83A Heteroyohimbine synthase hys from catharanthus roseus - apo form (see paper)
39% identity, 98% coverage: 2:350/355 of query aligns to 8:349/354 of 5h83A
Query Sequence
>Ga0059261_2135 FitnessBrowser__Korea:Ga0059261_2135
MPSPAKAYAAQSATTPLAPFSFERRDVQPDDVAIDILFCGVCHSDLHQARSEWEGTLFPC
VPGHEIVGRVTAIGSDVTTFAVGDLVGVGCMVDSCGTCPSCHEGEEQYCEGTGFVGTYNG
PDAHLGGHTFGGYSDTIVVKQGFVLRIGHDEQDLAAVAPLLCAGITTYSPLKHWGAGPGK
KVGVVGIGGLGHMGVKIAAAMGAHVVAFTTSEGKRADALALGAHEVVVSRNADEMAAHAG
SFDFILNTVAASHDLDAFTNLLKRDGTMTLVGVPEHAHPSPSVLNLVFRRRSIAGSLIGG
IAETQEMLDFCRDHGITADIETIAIQDIDASFDRMVKGDVKYRFVIDMASLAAVA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory