Comparing Ga0059261_2194 FitnessBrowser__Korea:Ga0059261_2194 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2cy0A Crystal structure of shikimate 5-dehydrogenase (aroe) from thermus thermophilus hb8 in complex with NADP (see paper)
41% identity, 92% coverage: 8:256/270 of query aligns to 6:248/262 of 2cy0A
2hk9B Crystal structure of shikimate dehydrogenase from aquifex aeolicus in complex with shikimate and NADP+ at 2.2 angstrom resolution (see paper)
33% identity, 95% coverage: 1:257/270 of query aligns to 1:256/267 of 2hk9B
2ev9B Crystal structure of shikimate 5-dehydrogenase (aroe) from thermus thermophilus hb8 in complex with NADP(h) and shikimate (see paper)
41% identity, 92% coverage: 8:256/270 of query aligns to 6:248/263 of 2ev9B
Q5SJF8 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
41% identity, 92% coverage: 8:256/270 of query aligns to 6:248/263 of Q5SJF8
2hk9A Crystal structure of shikimate dehydrogenase from aquifex aeolicus in complex with shikimate and NADP+ at 2.2 angstrom resolution (see paper)
33% identity, 95% coverage: 1:257/270 of query aligns to 1:256/269 of 2hk9A
O67049 Shikimate dehydrogenase (NADP(+)); SD; SDH; EC 1.1.1.25 from Aquifex aeolicus (strain VF5) (see paper)
33% identity, 95% coverage: 1:257/270 of query aligns to 1:256/269 of O67049
7colA Crystal structure of 5-ketofructose reductase complexed with NADPH (see paper)
39% identity, 83% coverage: 30:253/270 of query aligns to 32:262/280 of 7colA
3pgjA 2.49 angstrom resolution crystal structure of shikimate 5- dehydrogenase (aroe) from vibrio cholerae o1 biovar eltor str. N16961 in complex with shikimate
32% identity, 94% coverage: 3:256/270 of query aligns to 2:257/272 of 3pgjA
Q9KVT3 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
32% identity, 94% coverage: 3:256/270 of query aligns to 6:261/278 of Q9KVT3
Q5HNV1 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Staphylococcus epidermidis (strain ATCC 35984 / RP62A) (see paper)
28% identity, 92% coverage: 8:256/270 of query aligns to 5:252/269 of Q5HNV1
3tnlA 1.45 angstrom crystal structure of shikimate 5-dehydrogenase from listeria monocytogenes in complex with shikimate and NAD.
30% identity, 95% coverage: 8:264/270 of query aligns to 15:286/288 of 3tnlA
3tozA 2.2 angstrom crystal structure of shikimate 5-dehydrogenase from listeria monocytogenes in complex with NAD.
30% identity, 95% coverage: 8:264/270 of query aligns to 18:289/291 of 3tozA
Q8Y9N5 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
30% identity, 95% coverage: 8:264/270 of query aligns to 18:289/291 of Q8Y9N5
P15770 Shikimate dehydrogenase (NADP(+)); SD; SDH; EC 1.1.1.25 from Escherichia coli (strain K12) (see paper)
31% identity, 93% coverage: 8:259/270 of query aligns to 6:260/272 of P15770
Q58484 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
33% identity, 96% coverage: 1:259/270 of query aligns to 1:270/282 of Q58484
1nytA Shikimate dehydrogenase aroe complexed with NADP+ (see paper)
31% identity, 93% coverage: 8:259/270 of query aligns to 6:260/271 of 1nytA
1nvtB Crystal structure of shikimate dehydrogenase (aroe or mj1084) in complex with NADP+ (see paper)
33% identity, 96% coverage: 1:259/270 of query aligns to 6:275/287 of 1nvtB
1nvtA Crystal structure of shikimate dehydrogenase (aroe or mj1084) in complex with NADP+ (see paper)
33% identity, 96% coverage: 1:259/270 of query aligns to 6:275/287 of 1nvtA
2o7sA Crystal structure of the a. Thaliana dhq-dehydroshikimate-sdh- shikimate-NADP(h)
32% identity, 96% coverage: 2:259/270 of query aligns to 234:482/500 of 2o7sA
Sites not aligning to the query:
2o7qA Crystal structure of the a. Thaliana dhq-dehydroshikimate-sdh- shikimate-NADP(h)
32% identity, 96% coverage: 2:259/270 of query aligns to 234:483/501 of 2o7qA
Sites not aligning to the query:
>Ga0059261_2194 FitnessBrowser__Korea:Ga0059261_2194
MTNAYAEVIGDPIAQSKSPVIHGFWLDKLGLSASYRKTHVTAEGLAGFFASRRDDPNWRG
CNITAPHKIASLDHVPDPGGVRDTIGAINTVFRSAEGTLIGTNTDAAGFYAPLAEFDLEG
APVAMVGAGGAARAILFALARAGVGHVTILNRSPLKAMGLLATFGLKGDVVALNAPIPPV
ALLVNASSLGMTGQPPLELDLGNLPDDAVVYDAVYAPLETGLLAAARARDLDTVDGLEML
IGQAALAFELFFGNAPPREHDAELRALLTA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory