Comparing Ga0059261_2228 FitnessBrowser__Korea:Ga0059261_2228 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2xf4A Crystal structure of salmonella enterica serovar typhimurium ycbl (see paper)
52% identity, 94% coverage: 9:217/223 of query aligns to 1:210/210 of 2xf4A
7ev5A Crystal structure of bleg-1 b3 metallo-beta-lactamase (see paper)
33% identity, 91% coverage: 14:215/223 of query aligns to 5:207/209 of 7ev5A
2zziA Crystal structure of ttha1623 in a di-iron-bound form (see paper)
34% identity, 91% coverage: 13:215/223 of query aligns to 1:198/198 of 2zziA
2zwrB Crystal structure of ttha1623 from thermus thermophilus hb8 (see paper)
34% identity, 91% coverage: 13:215/223 of query aligns to 3:200/207 of 2zwrB
7l0bA Crystal structure of hydroxyacyl glutathione hydrolase (glob) from staphylococcus aureus, apoenzyme (see paper)
32% identity, 80% coverage: 38:215/223 of query aligns to 29:200/202 of 7l0bA
5ve5A Crystal structure of persulfide dioxygenase rhodanese fusion protein with rhodanese domain inactivating mutation (c314s) from burkholderia phytofirmans in complex with glutathione (see paper)
30% identity, 87% coverage: 20:213/223 of query aligns to 12:194/350 of 5ve5A
Sites not aligning to the query:
3tp9A Crystal structure of alicyclobacillus acidocaldarius protein with beta-lactamase and rhodanese domains
31% identity, 68% coverage: 19:170/223 of query aligns to 13:160/473 of 3tp9A
O95571 Persulfide dioxygenase ETHE1, mitochondrial; Ethylmalonic encephalopathy protein 1; Hepatoma subtracted clone one protein; Sulfur dioxygenase ETHE1; EC 1.13.11.18 from Homo sapiens (Human) (see 4 papers)
29% identity, 73% coverage: 51:213/223 of query aligns to 66:213/254 of O95571
Sites not aligning to the query:
4chlB Human ethylmalonic encephalopathy protein 1 (hethe1) (see paper)
29% identity, 73% coverage: 51:213/223 of query aligns to 50:197/237 of 4chlB
4efzA Crystal structure of a hypothetical metallo-beta-lactamase from burkholderia pseudomallei
31% identity, 79% coverage: 44:219/223 of query aligns to 52:242/295 of 4efzA
4ysbA Crystal structure of ethe1 from myxococcus xanthus (see paper)
27% identity, 83% coverage: 31:216/223 of query aligns to 23:191/225 of 4ysbA
2gcuA X-ray structure of gene product from arabidopsis thaliana at1g53580 (see paper)
27% identity, 77% coverage: 43:213/223 of query aligns to 40:201/244 of 2gcuA
Q9C8L4 Persulfide dioxygenase ETHE1 homolog, mitochondrial; Glyoxalase II; Glx II; Sulfur dioxygenase ETHE1; EC 1.13.11.18 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
27% identity, 77% coverage: 43:213/223 of query aligns to 89:250/294 of Q9C8L4
6sg9FL uS3m (see paper)
36% identity, 40% coverage: 124:212/223 of query aligns to 206:294/320 of 6sg9FL
Sites not aligning to the query:
5k0wB Crystal structure of the metallo-beta-lactamase gob-18 from elizabethkingia meningoseptica (see paper)
34% identity, 45% coverage: 46:146/223 of query aligns to 58:163/271 of 5k0wB
Sites not aligning to the query:
3r2uB 2.1 angstrom resolution crystal structure of metallo-beta-lactamase from staphylococcus aureus subsp. Aureus col
26% identity, 91% coverage: 19:221/223 of query aligns to 15:227/336 of 3r2uB
Sites not aligning to the query:
3r2uA 2.1 angstrom resolution crystal structure of metallo-beta-lactamase from staphylococcus aureus subsp. Aureus col
31% identity, 68% coverage: 19:170/223 of query aligns to 13:159/348 of 3r2uA
Sites not aligning to the query:
4ad9A Crystal structure of human lactb2. (see paper)
27% identity, 70% coverage: 46:200/223 of query aligns to 59:200/288 of 4ad9A
Q53H82 Endoribonuclease LACTB2; Beta-lactamase-like protein 2; EC 3.1.27.- from Homo sapiens (Human) (see paper)
27% identity, 70% coverage: 46:200/223 of query aligns to 59:200/288 of Q53H82
Sites not aligning to the query:
7zo6A L1 metallo-beta-lactamase in complex with hydrolysed cefoxitin (see paper)
30% identity, 47% coverage: 43:146/223 of query aligns to 62:165/265 of 7zo6A
Sites not aligning to the query:
>Ga0059261_2228 FitnessBrowser__Korea:Ga0059261_2228
MNTASTPPLRAAIVPVTPLQQNSTLLWCTETMRGAFTDPGGDLDRLKAAAQQHGVTIEKL
LITHGHIDHCGQAGMLAKELGVPIEGPHEADRFWISRLDDDGRKYGIDGKPFEPDRWLVD
GDTVTVGNLTLDVYHCPGHTPGHVVFHHAPSKLAIVGDVIFQGSIGRTDFPMGNHQDLLD
AITGKLWPLGGDTVFVPGHGQPSNFAQERRTNPFVADAVLARS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory