SitesBLAST
Comparing Ga0059261_2250 FitnessBrowser__Korea:Ga0059261_2250 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4yerA Crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution
41% identity, 86% coverage: 6:269/307 of query aligns to 5:267/285 of 4yerA
- binding adenosine-5'-diphosphate: F14 (≠ Y15), F17 (≠ K19), N39 (= N41), G40 (= G42), G42 (= G44), K43 (= K45), T44 (≠ S46), T45 (= T47), T135 (= T135), F136 (≠ L136), S137 (= S137)
Q99758 Phospholipid-transporting ATPase ABCA3; ABC-C transporter; ATP-binding cassette sub-family A member 3; ATP-binding cassette transporter 3; ATP-binding cassette 3; Xenobiotic-transporting ATPase ABCA3; EC 7.6.2.1; EC 7.6.2.2 from Homo sapiens (Human) (see 15 papers)
41% identity, 68% coverage: 4:213/307 of query aligns to 528:741/1704 of Q99758
- N568 (= N41) to D: in SMDP3; does not affect location in intracellular vesicle membrane; does not affect proteolytic cleavage; does not affect N-glycosylation; loss of ATP hydrolysis activity; decreases ATP binding in vitro; does not affect protein expression; does not affect multivesicular bodies and lamellar bodies location; affects multivesicular bodies and lamellar bodies development; loss of phosphatidylcholine transport; does not affect cholesterol transport; dbSNP:rs121909184
- L579 (= L52) to P: in SMDP3; uncertain significance
- R605 (≠ K78) to Q: in SMDP3; uncertain significance; dbSNP:rs760006956
- S693 (≠ A164) mutation to L: Does not affect protein oligomerization.
Sites not aligning to the query:
- 43 R → L: in SMDP3; uncertain significance
- 53 N→Q: Does not affect N-glycosylation. Does not affect protein expression. Does not affect lamellar body membrane location.
- 101 L → P: in SMDP3; loss of intracellular vesicle membrane location; loss of proteolytic cleavage; does not affect N-glycosylation; loss of ATP hydrolysis activity; decreases ATP binding in vitro; dbSNP:rs121909182
- 124 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→Q: Loss of N-glycosylation. Reduces protein expression by 50%. Affects anterograde trafficking; when associated with Q-140. Reduces protein expression by 85%; when associated with Q-140. Does not affect lamellar body membrane location.
- 140 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N → H: in dbSNP:rs45447801; N→Q: Loss of N-glycosylation. Reduces protein expression by 50%. Affects anterograde trafficking; when associated with Q-124. Reduces protein expression by 85%; when associated with Q-140. Does not affect lamellar body membrane location.
- 173:174 LK→AA: Loss of proteolytic processing.
- 174:175 Cleavage; by CTSL
- 215 Q → K: in SMDP3; loss of lamellar bodies membrane location; loss of proteolytic cleavage; increases cellular free cholesterol and phosphatidylcholine transport; loss of vesicles formation; increases free cholesterol induced cell death; loss of protein oligomerization; dbSNP:rs879159551
- 280 R → C: in SMDP3; uncertain significance; does not affect protein oligomerization; dbSNP:rs201299260
- 288 R → K: in SMDP3; uncertain significance; does not affect protein oligomerization; dbSNP:rs117603931
- 290 L → M: in a breast cancer sample; somatic mutation
- 292 E → V: in SMDP3; uncertain significance; does not affect lamellar bodies membrane location; does not affect proteolytic cleavage; affects lamellar bodies formation; does not affect cholesterol and phosphatidylcholine transport; decreases vesicles formation; does not affect free cholesterol induced cell death; dbSNP:rs149989682
- 766 P → S: in dbSNP:rs45592239
- 801 E → D: in a breast cancer sample; somatic mutation
- 945 N→Q: Does not affect lamellar body membrane location. Does not affect protein expression. Does not affect proteolytic processing.
- 982 L → P: in SMDP3; loss of intracellular vesicle membrane location; loss of proteolytic cleavage; does not affect N-glycosylation; dbSNP:rs1402761450
- 1069 H → Q: in a breast cancer sample; somatic mutation
- 1076 N → K: in SMDP3; uncertain significance
- 1221 G → S: in SMDP3; does not affect intracellular vesicle membrane location; does not affect proteolytic cleavage; does not affect N-glycosylation; loss of ATP hydrolysis activity; G→A: Decreases ATP hydrolysis activity of 15% compared to the wild-type.; G→T: Decreases ATP hydrolysis activity of 36% compared to the wild-type.; G→V: Decreases ATP hydrolysis activity of 18% compared to the wild-type.
- 1302 G → E: in SMDP3; uncertain significance
- 1388 K → N: in SMDP3; decreases phosphatidylcholine transport; increases protein abundance; does not affect folding in the endoplasmic reticulum; decreases proteolytic processing; affects lamellar bodies development; reduces free cholesterol transport
- 1553 L → P: in SMDP3; loss of intracellular vesicle membrane location; loss of proteolytic cleavage; does not affect N-glycosylation; dbSNP:rs121909183
- 1580 L → P: in SMDP3; does not affect location in intracellular vesicle membrane; does not affect proteolytic cleavage; does not affect N-glycosylation; loss of ATP hydrolysis activity; decreases ATP binding in vitro; affects the intracellular vesicles development; decreases phosphatidylcholine transport; L→A: Decreases ATP hydrolysis activity of 13% compared to the wild-type.; L→F: Decreases ATP hydrolysis activity of 13% compared to the wild-type.; L→V: Decreases ATP hydrolysis activity of 56% compared to the wild-type.
- 1591 Q → P: in SMDP3; loss of intracellular vesicle membrane location; loss of proteolytic cleavage; does not affect N-glycosylation; dbSNP:rs28936691
7w02A Cryo-em structure of atp-bound abca3 (see paper)
41% identity, 68% coverage: 4:213/307 of query aligns to 493:706/1566 of 7w02A
- binding adenosine-5'-triphosphate: F504 (≠ Y15), N533 (= N41), G534 (= G42), G536 (= G44), K537 (= K45), T538 (≠ S46), T539 (= T47), Q578 (= Q86), L630 (= L136), S631 (= S137)
- binding magnesium ion: T538 (≠ S46), Q578 (= Q86)
Sites not aligning to the query:
- binding adenosine-5'-triphosphate: 1277, 1305, 1306, 1307, 1308, 1309, 1310, 1344, 1395, 1398
- binding magnesium ion: 1310, 1344
Q8R420 Phospholipid-transporting ATPase ABCA3; ATP-binding cassette sub-family A member 3; Xenobiotic-transporting ATPase ABCA3; EC 7.6.2.1; EC 7.6.2.2 from Mus musculus (Mouse) (see paper)
40% identity, 68% coverage: 4:213/307 of query aligns to 528:741/1704 of Q8R420
Sites not aligning to the query:
- 292 E→V: Knockin new born mice are healthy and survive into adulthood without overt signs of respiratory distress. Knockin mice show a severe lung phenotype that begins with alveolar inflammatory cell infiltration at the early stage of the mouse life followed by aberrant lung remodeling with characteristics of diffuse parenchymal lung disease (DPLD)- and emphysema-like alveolar disruption in older mice.
Q9BZC7 ATP-binding cassette sub-family A member 2; ATP-binding cassette transporter 2; ATP-binding cassette 2; EC 7.6.2.- from Homo sapiens (Human) (see paper)
40% identity, 67% coverage: 8:213/307 of query aligns to 992:1199/2435 of Q9BZC7
Sites not aligning to the query:
- 271 modified: N5-methylglutamine; Q→R: Abolishes methylation by N6AMT1.
P34358 ABC transporter ced-7; Cell death protein 7 from Caenorhabditis elegans (see 2 papers)
38% identity, 72% coverage: 4:225/307 of query aligns to 544:767/1704 of P34358
- K586 (= K45) mutation to R: Cell corpses not engulfed.
- E639 (= E101) mutation to G: Cell corpses not engulfed.
Sites not aligning to the query:
- 126 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 1012 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 1045 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 1417 K→R: Some cell corpses not engulfed.
O95477 Phospholipid-transporting ATPase ABCA1; ATP-binding cassette sub-family A member 1; ATP-binding cassette transporter 1; ABC-1; ATP-binding cassette 1; Cholesterol efflux regulatory protein; EC 7.6.2.1 from Homo sapiens (Human) (see 35 papers)
40% identity, 69% coverage: 5:215/307 of query aligns to 898:1111/2261 of O95477
- D917 (= D23) to Y: in a colorectal cancer sample; somatic mutation
- T929 (≠ F35) to I: in TGD; moderately decreased protein abundance; highly decreased ATPase activity; highly decreased phospholipid translocase activity; loss protein subcellular localization to the plasma membrane
- N935 (= N41) to S: in TGD; moderately decreased protein abundance; highly decreased ATPase activity; highly decreased phospholipid translocase activity; dbSNP:rs28937313
- K939 (= K45) mutation to M: Inhibits ATPase activity; when associated with M-1952. Decreases translocase activity; when associated with M-1952. Does not affect protein subcellular localization in plasma membrane and endosome; when associated with M-1952.
- S1042 (≠ M145) modified: Phosphoserine; by PKA
- P1065 (≠ I168) natural variant: P -> S
- M1091 (≠ L195) to T: in FHA1; loss of localization to plasma membrane; decreased cholesterol efflux; decreased phospholipid efflux
- C1110 (≠ I214) modified: S-palmitoyl cysteine; mutation to S: Decreased palmitoylation; when associated with S-3, S-23 and S-1111.
- C1111 (≠ A215) modified: S-palmitoyl cysteine; mutation to S: Decreased palmitoylation; when associated with S-3, S-23 and S-1110.
Sites not aligning to the query:
- 3 modified: S-palmitoyl cysteine; C→S: Mild decrease of palmitoylation. Loss of localization to plasma membrane. Decreased cholesterol efflux. Decreased phospholipid efflux. Decreased palmitoylation; when associated with S-23, S-1110 and S-1111.
- 23 modified: S-palmitoyl cysteine; C→S: Mild decrease of palmitoylation. Loss of localization to plasma membrane. Decreased palmitoylation; when associated with S-3, S-1110 and S-1111.
- 74 I→C: 85-90% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with C-371.; I→K: 85-90% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with E-371.
- 75 modified: Disulfide link with 309
- 85 P → L: in FHA1; Alabama; dbSNP:rs145183203
- 98 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 100 S→C: Highly decreased protein abundance. Highly decreased ATPase activity. Highly decreased phospholipid translocase activity.
- 210 E → D: in a colorectal cancer sample; somatic mutation
- 219 R → K: in dbSNP:rs2230806
- 230 R → C: in dbSNP:rs9282541
- 244 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 248 P → A: in dbSNP:rs142625938
- 255 A → T: in TGD; deficient cellular cholesterol efflux; dbSNP:rs758100110
- 304 V→C: No effect on phospholipid and cholesterol efflux or localization to cell membrane; when associated with C-308.
- 308 V→C: No effect on phospholipid and cholesterol efflux or localization to cell membrane; when associated with C-304.
- 309 modified: Disulfide link with 75
- 364 S → C: in dbSNP:rs775035559
- 371 I→C: No effect on phospholipid and cholesterol efflux or localization to cell membrane. 85-90% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with C-74 or C-375.; I→E: 85-90% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with K-74.
- 375 L→C: 85-90% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with C-371.
- 399 V → A: in dbSNP:rs9282543
- 401 K → Q: in dbSNP:rs138487227
- 496 R → W: in dbSNP:rs147675550
- 568 K→A: 60-65% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane.
- 573 Y→F: No effect on phospholipid and cholesterol efflux and on localization to cell membrane.
- 581 D→K: 80-85% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with K-584 and K-585.
- 583 F→K: 90-95% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with E-590.
- 584 E→K: 80-85% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with K-581 and K-585.
- 585 D→K: 80-85% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with K-581 and K-584.
- 590 W → S: in TGD; moderately decreased protein abundance; highly decreased ATPase activity; highly decreased phospholipid translocase activity; dbSNP:rs137854496; W→E: 90-95% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with K-583.
- 593 F→L: Moderately decreased protein abundance. Highly decreased ATPase activity. Highly decreased phospholipid translocase activity.
- 638 R → Q: in dbSNP:rs374190304
- 771 V → M: in dbSNP:rs2066718
- 774 T → P: in dbSNP:rs35819696; natural variant: T -> S
- 776 K → N: in dbSNP:rs138880920
- 815 E → G: in dbSNP:rs145582736
- 825 V → I: in dbSNP:rs2066715
- 883 I → M: in dbSNP:rs2066714
- 1172 E → D: in dbSNP:rs33918808
- 1181 S → F: in dbSNP:rs76881554
- 1216 G → V: in dbSNP:rs562403512
- 1341 R → T: in dbSNP:rs147743782
- 1376 S → G: in dbSNP:rs145689805
- 1379 L → F: in TGD; the mutant protein is retained in the endoplasmic reticulum while the wild-type protein is located at the plasma membrane
- 1407 A → T: in a colorectal cancer sample; somatic mutation; dbSNP:rs189206655
- 1463 modified: Disulfide link with 1477
- 1477 modified: Disulfide link with 1463; C → R: in TGD; loss of interaction with APOE; unable to generate APOE-containing high density lipoproteins; moderately decreased protein abundance; moderately decreased ATPase activity; moderately decreased phospholipid translocase activity; dbSNP:rs137854494
- 1512 T→M: Moderately decreased protein abundance. Does not affect ATPase activity. Moderately decreased phospholipid translocase activity.
- 1555 I → T: in dbSNP:rs1997618
- 1587 K → R: in dbSNP:rs2230808
- 1611 N → D: in FHA1; deficient cellular cholesterol efflux
- 1615 R → Q: in dbSNP:rs1251839800
- 1648 L → P: in dbSNP:rs1883024
- 1670 A → T: in dbSNP:rs1203589782
- 1680 R → Q: in dbSNP:rs150125857
- 1704 V → D: in TGD; the mutant protein is retained in the endoplasmic reticulum while the wild-type protein is located at the plasma membrane
- 1731 S → C: in dbSNP:rs760507032
- 1897 R → W: in FHA1; uncertain significance; dbSNP:rs760768125
- 1925 R → Q: in Scott syndrome; shows impaired trafficking of the mutant protein to the plasma membrane; dbSNP:rs142688906
- 1952 K→M: Inhibits ATPase activity; when associated with M-939. Decreases translocase activity; when associated with M-939. Does not affect protein subcellular localization in plasma membrane and endosome; when associated with M-939.
- 2054 modified: Phosphoserine; by PKA
- 2081 R → W: in TGD; highly decreased protein abundance; highly decreased ATPase activity; highly decreased phospholipid translocase activity; loss protein subcellular localization to the plasma membrane; dbSNP:rs137854501
- 2109 A → T: in a colorectal cancer sample; somatic mutation
- 2150 P → L: in FHA1; moderately decreased protein abundance; does not affect ATPase activity; moderately decreased phospholipid translocase activity; dbSNP:rs369098049
- 2163 natural variant: F -> S
- 2168 L → P: in dbSNP:rs2853577
- 2243 D → E: in dbSNP:rs34879708
- 2244 V → I: in dbSNP:rs144588452
P41233 Phospholipid-transporting ATPase ABCA1; ATP-binding cassette sub-family A member 1; ATP-binding cassette transporter 1; ABC-1; ATP-binding cassette 1; EC 7.6.2.1 from Mus musculus (Mouse) (see paper)
40% identity, 69% coverage: 5:215/307 of query aligns to 898:1111/2261 of P41233
Sites not aligning to the query:
- 489 modified: carbohydrate, N-linked (GlcNAc...) asparagine
8ee6A Cryo-em structure of human abca7 in pe/ch nanodiscs (see paper)
32% identity, 96% coverage: 8:303/307 of query aligns to 1500:1807/1808 of 8ee6A
Sites not aligning to the query:
7tbwA The structure of atp-bound abca1 (see paper)
40% identity, 68% coverage: 6:215/307 of query aligns to 754:966/1928 of 7tbwA
- binding adenosine-5'-triphosphate: Y763 (= Y15), D765 (≠ G17), K768 (= K19), N790 (= N41), G791 (= G42), G793 (= G44), K794 (= K45), T795 (≠ S46), Q835 (= Q86), Q887 (≠ T135), S889 (= S137), H944 (= H193)
- binding magnesium ion: Q835 (= Q86), D912 (= D160), Q913 (≠ E161)
Sites not aligning to the query:
- binding adenosine-5'-triphosphate: 1630, 1633, 1657, 1658, 1660, 1661, 1662, 1663, 1702, 1753, 1755, 1756, 1757, 1779, 1783, 1811
- binding cholesterol: 218, 219, 360, 367
- binding magnesium ion: 1662, 1702
E9Q876 Glucosylceramide transporter ABCA12; ATP-binding cassette sub-family A member 12; EC 7.6.2.1 from Mus musculus (Mouse) (see 2 papers)
36% identity, 68% coverage: 6:213/307 of query aligns to 1346:1555/2595 of E9Q876
- 1388:1461 (vs. 49:118, 24% identical) mutation to M: In a mouse model for harlequin ichthyosis (HI), smooth skin (smsk) mutant mice show a pronounced perinatal lethal skin phenotype in 25% of the offspring and newborn mutant pups die within a few hours after birth, and appear severely dehydrated with dry cracking skin. Smsk homozygous mutants embryos show a normal appearance at 14.5 dpc, but at 16.5 dpc develop a partial absence of normal skin folds around the trunk and limbs, and by 18.5 dpc develop a taut, thick skin and limb contractures.
Sites not aligning to the query:
- 1996 G→D: In a mouse model for harlequin ichthyosis (HI), homozygous mice are embryonic lethal but occasionally pups are found in the first few hours after birth but die and are severely dehydrated and fail to suckle normally. Homozygous pups show hallmarks of HI desease including hyperkeratosis, abnormal extracellular lipid lamellae and defects in cornified envelope processing. At 14.5 dpc and 15.5 dpc homozygous embryos appear normal; however from 16.5 dpc onwards they are characterized by an absence of normal skin folds around the trunk and limbs. As development progressed, embryos develop a taut, thick epidermis and multiple contractures affecting the limbs. Late stage embryos are smaller.
5x40A Structure of a cbio dimer bound with amppcp (see paper)
36% identity, 69% coverage: 6:216/307 of query aligns to 5:221/280 of 5x40A
- binding phosphomethylphosphonic acid adenylate ester: F14 (≠ Y15), V18 (≠ K19), A20 (= A21), N40 (= N41), G41 (= G42), G43 (= G44), K44 (= K45), S45 (= S46), T46 (= T47), Q88 (= Q86), H139 (≠ R134), M140 (≠ T135), L141 (= L136), S142 (= S137), G144 (= G139), Q145 (≠ M140), Q166 (≠ E161), H198 (= H193)
- binding magnesium ion: S45 (= S46), Q88 (= Q86)
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
33% identity, 76% coverage: 6:239/307 of query aligns to 2:249/343 of P30750
- 40:46 (vs. 41:47, 86% identical) binding
- E166 (= E161) mutation to Q: Exhibits little ATPase activity.
Sites not aligning to the query:
- 278:283 binding
- 295 N→A: Reduces the binding of L-methionine to undetectable levels.
- 295:296 binding
Q5SSE9 ATP-binding cassette sub-family A member 13; EC 7.6.2.- from Mus musculus (Mouse) (see paper)
30% identity, 99% coverage: 3:306/307 of query aligns to 3807:4131/5034 of Q5SSE9
- K3849 (= K45) mutation to M: Does not affect intracellular vesicle localization. Affects cholesterol internalization.
- T3999 (= T192) mutation to A: Does not affect protein expression. Affects intracellular vesicles localization. Impairs intracellular cholesterol accumulation in the vesicle.
Sites not aligning to the query:
- 3577 H→P: Does not affect protein expression. Decreases intracellular cholesterol accumulation in the vesicle.
- 4735 K→M: Does not affect intracellular vesicle localization.Affects cholesterol internalization.
- 4818 R→C: Does not affect protein expression. Decreases intracellular cholesterol accumulation in the vesicle.
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
32% identity, 76% coverage: 6:239/307 of query aligns to 3:250/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
32% identity, 76% coverage: 6:239/307 of query aligns to 3:250/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
32% identity, 76% coverage: 6:239/307 of query aligns to 3:250/344 of 6cvlD
- binding phosphothiophosphoric acid-adenylate ester: F12 (≠ Y15), Q14 (≠ G17), I19 (vs. gap), S41 (≠ N41), G42 (= G42), A43 (= A43), G44 (= G44), K45 (= K45), S46 (= S46), T47 (= T47), N141 (≠ T135), S143 (= S137), Q146 (≠ M140), H200 (= H193)
Q8N139 ATP-binding cassette sub-family A member 6; EC 7.6.2.- from Homo sapiens (Human) (see 2 papers)
31% identity, 93% coverage: 19:303/307 of query aligns to 1300:1591/1617 of Q8N139
- N1322 (= N41) to S: in dbSNP:rs2302134
Sites not aligning to the query:
- 282 V → I: in dbSNP:rs4968839
- 875 M → I: in dbSNP:rs7212506
- 940 modified: carbohydrate, N-linked (GlcNAc...) asparagine
8eopA Cryo-em structure of nanodisc reconstituted human abca7 eq mutant in atp bound closed state (see paper)
35% identity, 72% coverage: 8:229/307 of query aligns to 1454:1678/1687 of 8eopA
Sites not aligning to the query:
- binding adenosine-5'-triphosphate: 659, 662, 666, 686, 687, 689, 690, 691, 692, 782, 784
F1MWM0 Retinal-specific phospholipid-transporting ATPase ABCA4; ATP-binding cassette sub-family A member 4; RIM ABC transporter; RIM protein; RmP; Retinal-specific ATP-binding cassette transporter; EC 7.6.2.1 from Bos taurus (Bovine) (see 2 papers)
36% identity, 68% coverage: 6:213/307 of query aligns to 1936:2146/2281 of F1MWM0
Sites not aligning to the query:
- 415 modified: carbohydrate, N-linked (Hex...) asparagine
- 504 modified: carbohydrate, N-linked (Hex...) asparagine
- 901 modified: Phosphothreonine; T→A: Decreases expression level. Affects subcellular location.
- 1185 modified: Phosphoserine; S→A: Does not affect subcellular location. Does not affect expression level. Does not affect ATPase activity. Reduces the stimulating effect of all-trans-retinal on ATP hydrolysis.
- 1309 Cleavage; by trypsin
- 1313 modified: Phosphothreonine; T→A: Does not affect subcellular location. Does not affect expression level. Does not affect ATPase activity. Reduces the stimulating effect of all-trans-retinal on ATP hydrolysis.
- 1317 modified: Phosphoserine; S→A: Does not affect subcellular location. Does not affect expression level. Affects both the basal and stimulated ATPase activity.
- 1319 modified: Phosphoserine
- 1455 modified: carbohydrate, N-linked (Hex...) asparagine
- 1527 modified: carbohydrate, N-linked (Hex...) asparagine
- 1660 modified: carbohydrate, N-linked (Hex...) asparagine
Query Sequence
>Ga0059261_2250 FitnessBrowser__Korea:Ga0059261_2250
MSDAAIEIEGLSKVYQGGKQALDDVSFTVPRGQIFGLLGPNGAGKSTLINILAGLVNKTA
GRASIWGFDIDQHPRNAKRAIGIVNQEILFDPFFTPVETLEIQAGLYGVPKAQRRSMELL
RAVHLEDKAHAYSRTLSGGMKRRLMVAKAMVHSPPVLVLDEPTAGVDIELRQQLWAYVRS
LNERGVTVVLTTHYLEEAEELCDRIAIINHGKLIANEPTRELVGKTQEKAVEVTVDRDIA
AVPDSRCFQKIEVKGDRTLVITYAKDQANAGEVLGAVQAAGFGIVDVSTREADLEDVFLS
LTRAANC
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory