Comparing Ga0059261_2272 FitnessBrowser__Korea:Ga0059261_2272 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 16 hits to proteins with known functional sites (download)
1qs0B Crystal structure of pseudomonas putida 2-oxoisovalerate dehydrogenase (branched-chain alpha-keto acid dehydrogenase, e1b) (see paper)
72% identity, 95% coverage: 16:352/353 of query aligns to 1:337/338 of 1qs0B
2j9fD Human branched-chain alpha-ketoacid dehydrogenase-decarboxylase e1b (see paper)
48% identity, 96% coverage: 13:352/353 of query aligns to 1:328/329 of 2j9fD
P21953 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial; Branched-chain alpha-keto acid dehydrogenase E1 component beta chain; BCKDE1B; BCKDH E1-beta; EC 1.2.4.4 from Homo sapiens (Human) (see 2 papers)
48% identity, 96% coverage: 13:352/353 of query aligns to 64:391/392 of P21953
1dtwB Human branched-chain alpha-keto acid dehydrogenase (see paper)
48% identity, 95% coverage: 19:352/353 of query aligns to 4:325/326 of 1dtwB
1umdD Branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 with 4-methyl-2-oxopentanoate as an intermediate (see paper)
53% identity, 94% coverage: 20:351/353 of query aligns to 3:321/323 of 1umdD
1umcD Branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 with 4-methylpentanoate (see paper)
53% identity, 94% coverage: 20:351/353 of query aligns to 3:321/323 of 1umcD
1umbD Branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 in holo-form (see paper)
53% identity, 94% coverage: 20:351/353 of query aligns to 3:321/323 of 1umbD
Q5SLR3 2-oxoisovalerate dehydrogenase subunit beta; Branched-chain alpha-keto acid dehydrogenase E1 component beta chain; BCKDH E1-beta; EC 1.2.4.4 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
53% identity, 94% coverage: 20:351/353 of query aligns to 4:322/324 of Q5SLR3
3dv0D Snapshots of catalysis in the e1 subunit of the pyruvate dehydrogenase multi-enzyme complex (see paper)
49% identity, 95% coverage: 19:352/353 of query aligns to 2:323/324 of 3dv0D
3dv0B Snapshots of catalysis in the e1 subunit of the pyruvate dehydrogenase multi-enzyme complex (see paper)
49% identity, 95% coverage: 19:352/353 of query aligns to 2:323/324 of 3dv0B
3dufD Snapshots of catalysis in the e1 subunit of the pyruvate dehydrogenase multi-enzyme complex (see paper)
49% identity, 95% coverage: 19:352/353 of query aligns to 2:323/324 of 3dufD
1w85B The crystal structure of pyruvate dehydrogenase e1 bound to the peripheral subunit binding domain of e2 (see paper)
49% identity, 95% coverage: 19:352/353 of query aligns to 2:323/324 of 1w85B
P11177 Pyruvate dehydrogenase E1 component subunit beta, mitochondrial; PDHE1-B; EC 1.2.4.1 from Homo sapiens (Human) (see 6 papers)
35% identity, 96% coverage: 14:352/353 of query aligns to 27:358/359 of P11177
Sites not aligning to the query:
6cfoB Human pyruvate dehydrogenase e1 component complex with covalent tdp adduct acetyl phosphinate (see paper)
36% identity, 93% coverage: 25:352/353 of query aligns to 9:329/330 of 6cfoB
6cerD Human pyruvate dehydrogenase complex e1 component v138m mutation (see paper)
36% identity, 93% coverage: 25:352/353 of query aligns to 10:330/331 of 6cerD
6yakDDD C-terminal component of the split chain transketolase (see paper)
31% identity, 26% coverage: 216:308/353 of query aligns to 166:264/311 of 6yakDDD
Sites not aligning to the query:
>Ga0059261_2272 FitnessBrowser__Korea:Ga0059261_2272
MSEAIVSETATGEAGAGTRMNMIQAINSALDVMMARDPDVIVMGEDVGYFGGVFRATAGL
QAKHGKTRVFDTPITECGIVGVAIGMGAYGLRPVPEIQFADYIYPALDQLVSEAARLRYR
SGGQFTAPLTIRSPYGGGIFGGQTHSQSPEGIFTHVSGVKTVIPSTPYDAKGLLIASIED
NDPVIFFEPKRIYNGPFNGHWDRPAENWSKHPGGEVPEGYYRVELGKAAIVRPGEALTVL
AYGTMVHVVKATVEEMGIDAEIIDLRTLVPLDIETIEESVRKTGRCMVVHEATRTSGFGA
ELASLVQERCFYHLEAPVERVTGFDTPYPHSLEWAYFPGPVRIGQALKKILKD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory