SitesBLAST
Comparing Ga0059261_2312 FitnessBrowser__Korea:Ga0059261_2312 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6jr7A Flavobacterium johnsoniae gh31 dextranase, fjdex31a, complexed with glucose (see paper)
28% identity, 95% coverage: 37:798/801 of query aligns to 27:810/812 of 6jr7A
- binding alpha-D-glucopyranose: G249 (≠ Y257), D277 (= D285), W352 (= W361), W352 (= W361), W386 (= W395), D388 (= D397), R445 (= R464), D461 (= D480), Y500 (≠ F513), H530 (= H538), G533 (≠ V541)
Q9FN05 Probable glucan 1,3-alpha-glucosidase; Glucosidase II subunit alpha; Protein PRIORITY IN SWEET LIFE 5; Protein RADIAL SWELLING 3; EC 3.2.1.84 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
33% identity, 78% coverage: 103:728/801 of query aligns to 185:836/921 of Q9FN05
- S517 (≠ A402) mutation to F: In psl5-1; Compromised defense response induced by the bacterial elicitor elongation factor Tu (EF-Tu).
- S599 (= S491) mutation to F: In rsw3; temperature-sensitive radial swelling of roots and reduction in cellulose production.
5dkyA Crystal structure of glucosidase ii alpha subunit (dnj-bound from) (see paper)
32% identity, 75% coverage: 124:725/801 of query aligns to 219:832/928 of 5dkyA
5dkzA Crystal structure of glucosidase ii alpha subunit (alpha3-glc2-bound from) (see paper)
31% identity, 82% coverage: 124:777/801 of query aligns to 215:882/921 of 5dkzA
- binding alpha-D-glucopyranose: D250 (= D159), W362 (≠ Y257), D390 (= D285), M504 (= M398), R564 (= R464), W577 (= W477), D580 (= D480), D580 (= D480), F613 (= F513), F613 (= F513), H638 (= H538)
5dl0A Crystal structure of glucosidase ii alpha subunit (glc1man2-bound from) (see paper)
32% identity, 75% coverage: 124:725/801 of query aligns to 215:828/924 of 5dl0A
7kb6A Co-crystal structure of alpha glucosidase with compound 7 (see paper)
32% identity, 81% coverage: 79:728/801 of query aligns to 124:774/850 of 7kb6A
- binding (1S,2S,3R,4S,5S)-1-(hydroxymethyl)-5-[(6-{[2-nitro-4-(pyrimidin-2-yl)phenyl]amino}hexyl)amino]cyclohexane-1,2,3,4-tetrol: F210 (= F161), W307 (≠ Y257), D335 (= D285), I336 (= I286), W409 (= W361), W446 (= W395), D448 (= D397), F455 (= F404), R508 (= R464), D524 (= D480), F557 (= F513), H582 (= H538)
7k9tA Co-crystal structure of alpha glucosidase with compound 5 (see paper)
32% identity, 81% coverage: 79:728/801 of query aligns to 124:774/850 of 7k9tA
- binding (1S,2S,3R,4S,5S)-1-(hydroxymethyl)-5-{[(5Z)-6-{[2-nitro-4-(2H-1,2,3-triazol-2-yl)phenyl]amino}hex-5-en-1-yl]amino}cyclohexane-1,2,3,4-tetrol: F210 (= F161), W307 (≠ Y257), D335 (= D285), I336 (= I286), W409 (= W361), W446 (= W395), D448 (= D397), R508 (= R464), D524 (= D480), F557 (= F513), H582 (= H538)
5hjoA Murine endoplasmic reticulum alpha-glucosidase ii with bound substrate analogue (see paper)
31% identity, 91% coverage: 2:728/801 of query aligns to 29:778/854 of 5hjoA
- binding D-glucal: D213 (= D159), F215 (= F161), W413 (= W361), M453 (= M398), D528 (= D480)
- binding 2-deoxy-alpha-D-arabino-hexopyranose: W311 (≠ Y257), D339 (= D285), I340 (= I286), W450 (= W395), D452 (= D397), R512 (= R464), D528 (= D480), F561 (= F513), H586 (= H538)
5hjrA Murine endoplasmic reticulum alpha-glucosidase ii with bound covalent intermediate (see paper)
31% identity, 91% coverage: 2:728/801 of query aligns to 29:779/855 of 5hjrA
7kryA Co-crystal structure of alpha glucosidase with compound 11 (see paper)
31% identity, 91% coverage: 2:728/801 of query aligns to 29:778/854 of 7kryA
- binding (1S,2S,3R,4S,5S)-5-({6-[(4-azido-2-nitrophenyl)amino]hexyl}amino)-1-(hydroxymethyl)cyclohexane-1,2,3,4-tetrol: F214 (= F161), W311 (≠ Y257), D339 (= D285), I340 (= I286), W411 (≠ P359), C412 (≠ V360), W413 (= W361), W450 (= W395), D452 (= D397), F459 (= F404), D528 (= D480), F561 (= F513), H586 (= H538)
7kb8A Co-crystal structure of alpha glucosidase with compound 8 (see paper)
31% identity, 91% coverage: 2:728/801 of query aligns to 29:778/854 of 7kb8A
- binding (1S,2S,3R,4S,5S)-1-(hydroxymethyl)-5-[(4-{[2-nitro-4-(triazan-1-yl)phenyl]amino}butyl)amino]cyclohexane-1,2,3,4-tetrol: F214 (= F161), W311 (≠ Y257), D339 (= D285), I340 (= I286), W413 (= W361), W450 (= W395), D452 (= D397), F459 (= F404), R512 (= R464), D528 (= D480), F561 (= F513), H586 (= H538)
7kadA Co-crystal structure of alpha glucosidase with compound 6 (see paper)
31% identity, 91% coverage: 2:728/801 of query aligns to 29:778/854 of 7kadA
- binding (1S,2S,3R,4S,5S)-1-(hydroxymethyl)-5-[(6-{[2-nitro-4-(1H-1,2,3-triazol-1-yl)phenyl]amino}hexyl)amino]cyclohexane-1,2,3,4-tetrol: F214 (= F161), W311 (≠ Y257), D339 (= D285), I340 (= I286), W413 (= W361), W450 (= W395), D452 (= D397), F459 (= F404), D528 (= D480), F561 (= F513), H586 (= H538)
7k9oA Co-crystal structure of alpha glucosidase with compound 3 (see paper)
31% identity, 91% coverage: 2:728/801 of query aligns to 29:778/854 of 7k9oA
- binding (1~{S},2~{S},3~{R},4~{S},5~{S})-1-(hydroxymethyl)-5-[6-[[2-[oxidanyl(oxidanylidene)-$l^{4}-azanyl]-4-(1,2,3,4-tetrazol-1-yl)phenyl]amino]hexylamino]cyclohexane-1,2,3,4-tetrol: F214 (= F161), W311 (≠ Y257), D339 (= D285), I340 (= I286), W413 (= W361), W450 (= W395), D452 (= D397), M453 (= M398), F459 (= F404), R512 (= R464), D528 (= D480), F561 (= F513), H586 (= H538)
Q14697 Neutral alpha-glucosidase AB; Alpha-glucosidase 2; Glucosidase II subunit alpha; EC 3.2.1.207 from Homo sapiens (Human) (see 6 papers)
34% identity, 76% coverage: 123:728/801 of query aligns to 243:868/944 of Q14697
- R309 (≠ G185) to C: no effect on PKD1 and PKD2 localization to the cell surface; dbSNP:rs1063445
- T383 (= T239) to R: in PKD3; fails to promote PKD1 and PKD2 localization to the cell surface; dbSNP:rs879255642
- R400 (= R256) to L: in PKD3; fails to promote PKD1 and PKD2 localization to the cell surface; dbSNP:rs770519542
- D542 (= D397) mutation to N: Loss of activity.
- R590 (= R452) to P: found in a patient with polycystic liver disease; uncertain significance; dbSNP:rs1465649718
- H785 (≠ T647) to N: found in a patient affected by polycystic liver disease; uncertain significance; the patient carried additional PKHD1 variant; the mutation results in significantly reduced alpha-glucosidase activity; dbNP:rs753910059; dbSNP:rs753910059
- R817 (≠ Q681) to W: in PKD3; fails to promote PKD1 and PKD2 localization to the cell surface; dbSNP:rs879255643
- H850 (≠ K711) to Y: in dbSNP:rs114915323
Sites not aligning to the query:
- 4:5 natural variant: Missing (in PKD3; uncertain significance; no apparent effect on the endoplasmic reticulum localization; dbSNP:rs750723025)
- 95 Q → R: no effect on PKD1 and PKD2 localization to the cell surface; dbSNP:rs1392032530
- 97 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 232 T → A: no effect on PKD1 and PKD2 localization to the cell surface
- 815:944 natural variant: Missing (found in a patient with polycystic liver disease; uncertain significance; no apparent effect on the endoplasmic reticulum localization)
- 864:944 natural variant: Missing (found in a patient with polycystic liver disease; uncertain significance; no apparent effect on the endoplasmic reticulum localization; dbSNP:rs1210158408)
- 918:944 natural variant: Missing (found in a patient affected by polycystic liver disease; uncertain significance)
7k9qA Co-crystal structure of alpha glucosidase with compound 4 (see paper)
32% identity, 81% coverage: 79:728/801 of query aligns to 125:777/853 of 7k9qA
- binding (1S,2S,3R,4S,5S)-5-amino-1-(hydroxymethyl)cyclohexane-1,2,3,4-tetrol: W310 (≠ Y257), D338 (= D285), I339 (= I286), W449 (= W395), D451 (= D397), M452 (= M398), R511 (= R464), D527 (= D480), F560 (= F513), H585 (= H538)
7k9nA Co-crystal structure of alpha glucosidase with compound 2 (see paper)
32% identity, 81% coverage: 79:728/801 of query aligns to 125:777/853 of 7k9nA
- binding (1S,2S,3R,4S,5S)-1-(hydroxymethyl)-5-[(9-methoxynonyl)amino]cyclohexane-1,2,3,4-tetrol: W310 (≠ Y257), D338 (= D285), I339 (= I286), W412 (= W361), W449 (= W395), D451 (= D397), R511 (= R464), D527 (= D480), F560 (= F513), H585 (= H538), D589 (≠ N542)
5iefA Murine endoplasmic reticulum alpha-glucosidase ii with n-butyl-1- deoxynojirimycin (see paper)
31% identity, 91% coverage: 2:728/801 of query aligns to 29:781/858 of 5iefA
- binding (2r,3r,4r,5s)-1-butyl-2-(hydroxymethyl)piperidine-3,4,5-triol: W314 (≠ Y257), D342 (= D285), W453 (= W395), D455 (= D397), F462 (= F404), R515 (= R464), W528 (= W477), D531 (= D480), F564 (= F513), H589 (= H538)
5ieeA Murine endoplasmic reticulum alpha-glucosidase ii with 1- deoxynojirimycin (see paper)
31% identity, 91% coverage: 2:728/801 of query aligns to 29:781/857 of 5ieeA
5iedA Murine endoplasmic reticulum alpha-glucosidase ii with castanospermine (see paper)
31% identity, 91% coverage: 2:728/801 of query aligns to 29:781/857 of 5iedA
- binding castanospermine: W314 (≠ Y257), D342 (= D285), I343 (= I286), W416 (= W361), W453 (= W395), D455 (= D397), R515 (= R464), W528 (= W477), D531 (= D480), F564 (= F513), H589 (= H538)
5h9oA Complex of murine endoplasmic reticulum alpha-glucosidase ii with d- glucose (see paper)
31% identity, 91% coverage: 2:728/801 of query aligns to 29:781/857 of 5h9oA
Query Sequence
>Ga0059261_2312 FitnessBrowser__Korea:Ga0059261_2312
MRLLLTTLSAIAMAAPAAAQVRALDNGVEVTRGGMAVRVTALSASVLRVRMARDGQWPED
ASWAVPAEVRTRSTKVRARGDGFDTDALTVKVDPATLRLTVHERGGRLVMADNADPVMRA
DGSFELSFAMPVGERYFGLGDKTGPFDRRGASYVHWNTDTFGYGRETDPTYKSIPFYVTT
GGGFGSYGLFLDNPTRSWFDFGHRSDGELKIGAPDGPVDYYLIAGPMLSEVVQRYHGLTG
TAPLIAPWGLGYQQSRYSYMSDTEVRDLAARLRKERIPTDVIWLDIDFQDRNRPFTTNPK
TFPDLPRLARDLKSDGIGLVAITDLHIAHAPSQGYAPFDSGAAGNHFLRTAKGRTYVAPV
WPGDSVFPDFTREASRDWWGGLYKDFVRAGIAGFWNDMNEPAIFETPSKTMPLDTVHRIE
GDGFATREASHAEVHNVYGMQNSRATFEGLKRLDSAARPFVMTRATYAGGQRYAVTWTGD
NNATWDHLKLSVQQLVNLGLSGFSYSAADIGGFTGGPSPELLTRWMQIGAFTPVMRVHAA
VNTPRSEPWVDGPEHLALRRAAIEERYRLFPYLYAVAEQQARSGDPIMRPVFYNYASSGC
DSPMSFTLGRDLMVAASPKPESPQPYDVCLPKGGWYDYWTGRSVVATAGKTADSVTETPR
IDRLPVFVRAGAIIPRQPLVQSLSETPKGALELLVYPGDDCSGTLYLDDGKADAIARGAY
LRQSFRCSTTEKGLRIDLDARQGKLKPWWREIAMTVHAVSDLGAVRLGRRTIAARMDESA
DRVRFTLPDSAGAATITLVGP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory