SitesBLAST
Comparing Ga0059261_2339 FitnessBrowser__Korea:Ga0059261_2339 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8DLI5 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1) (see paper)
39% identity, 96% coverage: 1:425/441 of query aligns to 1:459/485 of Q8DLI5
- R6 (= R6) binding
- Y192 (= Y185) binding
2cfoA Non-discriminating glutamyl-tRNA synthetase from thermosynechococcus elongatus in complex with glu (see paper)
39% identity, 96% coverage: 2:425/441 of query aligns to 1:458/484 of 2cfoA
P04805 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Escherichia coli (strain K12) (see 4 papers)
32% identity, 100% coverage: 1:439/441 of query aligns to 1:457/471 of P04805
- C98 (≠ A97) mutation to S: 10-fold decrease in activity. Strong decrease in zinc content.
- C100 (≠ E99) mutation to S: Loss of activity. Strong decrease in zinc content.; mutation to Y: Does not prevent zinc binding. Reduces only 2-fold the binding affinity for tRNA(Glu), but reduces more than 10-fold the affinity for glutamate in the presence of tRNA(Glu).
- C125 (≠ L125) mutation to S: Loss of activity. Strong decrease in zinc content.
- H127 (≠ L127) mutation to Q: 10-fold decrease in activity. Strong decrease in zinc content.
- H129 (≠ D129) mutation to Q: No change in activity or in zinc content.
- H131 (≠ D131) mutation to Q: No change in activity or in zinc content.
- H132 (≠ R132) mutation to Q: No change in activity or in zinc content.
- C138 (≠ E138) mutation to S: No change in activity or in zinc content.
- S239 (= S242) modified: Phosphoserine; mutation to D: Does not aminoacylate tRNA(Glu), not phosphorylated by HipA.
8i9iA Glutamyl-tRNA synthetase from escherichia coli bound to glutamate and zinc
32% identity, 100% coverage: 1:439/441 of query aligns to 1:457/468 of 8i9iA
4g6zA Crystal structure of a glutamyl-tRNA synthetase glurs from burkholderia thailandensis bound to l-glutamate (see paper)
39% identity, 72% coverage: 3:318/441 of query aligns to 3:300/380 of 4g6zA
3al0C Crystal structure of the glutamine transamidosome from thermotoga maritima in the glutamylation state. (see paper)
30% identity, 99% coverage: 3:439/441 of query aligns to 103:555/564 of 3al0C
- active site: S110 (= S10), K335 (= K243)
- binding o5'-(l-glutamyl-sulfamoyl)-adenosine: R106 (= R6), A108 (= A8), P109 (= P9), G118 (= G18), T122 (= T22), E142 (≠ D42), Y276 (= Y185), R294 (= R203), G295 (= G204), D297 (= D206), H298 (= H207), L324 (= L233), I325 (≠ L234), L333 (= L241)
- binding : T144 (= T44), D145 (= D45), R148 (= R48), Y208 (≠ Q101), P213 (≠ L106), K252 (≠ R161), M255 (≠ Q164), I266 (≠ V175), K269 (≠ R178), S270 (≠ A179), Y276 (= Y185), D297 (= D206), H298 (= H207), L299 (≠ V208), S300 (= S209), N301 (= N210), K304 (≠ A213), R330 (≠ G239), P332 (vs. gap), G363 (= G271), W364 (≠ T272), R365 (≠ S273), E370 (≠ P278), S387 (≠ G295), K389 (≠ A297), V391 (≠ A299), I392 (≠ R300), K397 (≠ E305), W400 (≠ Q308), R407 (≠ H315), E446 (≠ P340), K447 (≠ N341), Q453 (≠ E347), I457 (vs. gap), R509 (≠ N393), K520 (= K404), Q524 (≠ L408), R527 (= R411), V535 (≠ S419), T536 (≠ G420), G538 (≠ D422), L539 (≠ M423)
6brlA Crystal structure of a glutamate tRNA ligase from elizabethkingia meningosepticum ccug26117 in complex with its amino acid
28% identity, 99% coverage: 3:440/441 of query aligns to 3:495/502 of 6brlA
1g59A Glutamyl-tRNA synthetase complexed with tRNA(glu). (see paper)
32% identity, 99% coverage: 3:439/441 of query aligns to 2:463/468 of 1g59A
- binding : D44 (= D45), R45 (≠ G46), A46 (≠ E47), R47 (= R48), P109 (≠ Q101), V145 (vs. gap), R163 (= R161), V166 (≠ Q164), E172 (≠ T170), V177 (= V175), K180 (≠ R178), S181 (≠ A179), D182 (= D180), E207 (= E205), E208 (≠ D206), R237 (≠ T235), K241 (≠ E238), T242 (≠ G239), K243 (= K240), M273 (≠ L270), G274 (= G271), E282 (≠ Q279), S299 (≠ G295), L300 (≠ R296), P303 (≠ A299), V304 (≠ R300), K309 (≠ E305), W312 (≠ Q308), R319 (≠ H315), P357 (= P340), R358 (≠ N341), R417 (≠ N393), K426 (= K402), L427 (≠ G403), Q432 (≠ L408), R435 (= R411), L442 (≠ D418), E443 (≠ S419), T444 (≠ G420), P445 (= P421), G446 (≠ D422), L447 (≠ M423), F448 (≠ A424)
2cv2A Glutamyl-tRNA synthetase from thermus thermophilus in complex with tRNA(glu) and an enzyme inhibitor, glu-ams (see paper)
32% identity, 99% coverage: 3:439/441 of query aligns to 2:463/468 of 2cv2A
- active site: K246 (= K243)
- binding o5'-(l-glutamyl-sulfamoyl)-adenosine: R5 (= R6), A7 (= A8), S9 (= S10), G17 (= G18), I21 (≠ T22), E41 (≠ D42), Y187 (= Y185), R205 (= R203), A206 (≠ G204), E208 (≠ D206), W209 (≠ H207), L235 (= L233), L236 (= L234)
- binding : S9 (= S10), T43 (= T44), D44 (= D45), R47 (= R48), V145 (vs. gap), R163 (= R161), Y168 (≠ F166), E172 (≠ T170), V177 (= V175), K180 (≠ R178), S181 (≠ A179), Y187 (= Y185), E207 (= E205), E208 (≠ D206), W209 (≠ H207), V211 (≠ S209), R237 (≠ T235), K241 (≠ E238), L272 (≠ R269), M273 (≠ L270), G274 (= G271), E282 (≠ Q279), S299 (≠ G295), P303 (≠ A299), V304 (≠ R300), K309 (≠ E305), W312 (≠ Q308), R319 (≠ H315), P357 (= P340), R358 (≠ N341), R417 (≠ N393), Q432 (≠ L408), R435 (= R411), L442 (≠ D418), E443 (≠ S419), T444 (≠ G420), G446 (≠ D422), L447 (≠ M423), F448 (≠ A424)
2cv1A Glutamyl-tRNA synthetase from thermus thermophilus in complex with tRNA(glu), atp, and an analog of l-glutamate: a quaternary complex
32% identity, 99% coverage: 3:439/441 of query aligns to 2:463/468 of 2cv1A
- active site: K246 (= K243)
- binding adenosine-5'-triphosphate: P8 (= P9), S9 (= S10), G17 (= G18), T18 (≠ N19), I21 (≠ T22), R47 (= R48), A206 (≠ G204), W209 (≠ H207), L235 (= L233), L236 (= L234)
- binding (4s)-4-amino-5-hydroxypentanoic acid: R5 (= R6), A7 (= A8), E41 (≠ D42), Y187 (= Y185), R205 (= R203), W209 (≠ H207)
- binding : S9 (= S10), E41 (≠ D42), T43 (= T44), D44 (= D45), R47 (= R48), V145 (vs. gap), R163 (= R161), V166 (≠ Q164), E172 (≠ T170), V177 (= V175), K180 (≠ R178), S181 (≠ A179), Y187 (= Y185), E207 (= E205), E208 (≠ D206), W209 (≠ H207), V211 (≠ S209), R237 (≠ T235), K241 (≠ E238), K243 (= K240), M273 (≠ L270), G274 (= G271), S276 (= S273), E282 (≠ Q279), S299 (≠ G295), P303 (≠ A299), V304 (≠ R300), K309 (≠ E305), W312 (≠ Q308), R319 (≠ H315), P357 (= P340), R358 (≠ N341), R417 (≠ N393), L427 (≠ G403), Q432 (≠ L408), R435 (= R411), L442 (≠ D418), E443 (≠ S419), T444 (≠ G420), G446 (≠ D422), L447 (≠ M423), F448 (≠ A424)
2cuzA Glutamyl-tRNA synthetase from thermus thermophilus in complex with l-glutamate (see paper)
32% identity, 99% coverage: 3:439/441 of query aligns to 2:463/468 of 2cuzA
1n78A Crystal structure of thermus thermophilus glutamyl-tRNA synthetase complexed with tRNA(glu) and glutamol-amp. (see paper)
32% identity, 99% coverage: 3:439/441 of query aligns to 2:463/468 of 1n78A
- active site: K246 (= K243)
- binding glutamol-amp: R5 (= R6), A7 (= A8), P8 (= P9), S9 (= S10), G17 (= G18), T18 (≠ N19), I21 (≠ T22), E41 (≠ D42), Y187 (= Y185), N191 (≠ S189), R205 (= R203), A206 (≠ G204), E208 (≠ D206), W209 (≠ H207), L235 (= L233), L236 (= L234)
- binding : S9 (= S10), T43 (= T44), D44 (= D45), R47 (= R48), V145 (vs. gap), R163 (= R161), V166 (≠ Q164), Y168 (≠ F166), E172 (≠ T170), V177 (= V175), K180 (≠ R178), S181 (≠ A179), Y187 (= Y185), E207 (= E205), E208 (≠ D206), W209 (≠ H207), L210 (≠ V208), V211 (≠ S209), R237 (≠ T235), K241 (≠ E238), M273 (≠ L270), G274 (= G271), E282 (≠ Q279), R297 (= R293), P303 (≠ A299), V304 (≠ R300), K309 (≠ E305), W312 (≠ Q308), R319 (≠ H315), P357 (= P340), R358 (≠ N341), R417 (≠ N393), L427 (≠ G403), Q432 (≠ L408), R435 (= R411), L442 (≠ D418), E443 (≠ S419), T444 (≠ G420), G446 (≠ D422), L447 (≠ M423), F448 (≠ A424)
1j09A Crystal structure of thermus thermophilus glutamyl-tRNA synthetase complexed with atp and glu (see paper)
32% identity, 99% coverage: 3:439/441 of query aligns to 2:463/468 of 1j09A
- active site: K246 (= K243)
- binding adenosine-5'-triphosphate: H15 (= H16), E208 (≠ D206), L235 (= L233), L236 (= L234), K243 (= K240), I244 (≠ L241), S245 (= S242), K246 (= K243), R247 (= R244)
- binding glutamic acid: R5 (= R6), A7 (= A8), S9 (= S10), E41 (≠ D42), Y187 (= Y185), N191 (≠ S189), R205 (= R203), W209 (≠ H207)
P27000 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
32% identity, 99% coverage: 3:439/441 of query aligns to 2:463/468 of P27000
- R358 (≠ N341) mutation to Q: Reduces affinity for tRNA and abolishes the ability to discriminate between tRNA(Glu) and tRNA(Gln).
4griB Crystal structure of a glutamyl-tRNA synthetase glurs from borrelia burgdorferi bound to glutamic acid and zinc (see paper)
27% identity, 99% coverage: 5:440/441 of query aligns to 4:476/485 of 4griB
- active site: S9 (= S10), K253 (= K243)
- binding glutamic acid: R5 (= R6), A7 (= A8), S9 (= S10), E41 (≠ D42), Y194 (= Y185), R212 (= R203), W216 (≠ H207)
- binding zinc ion: C105 (≠ A97), C107 (≠ E99), Y128 (= Y120), C132 (≠ A124)
8vc5A Crystal structure of glutamyl-tRNA synthetase glurs from pseudomonas aeruginosa (zinc bound)
33% identity, 73% coverage: 2:323/441 of query aligns to 3:330/488 of 8vc5A
4a91A Crystal structure of the glutamyl-queuosine trnaasp synthetase from e. Coli complexed with l-glutamate (see paper)
31% identity, 56% coverage: 4:248/441 of query aligns to 5:234/290 of 4a91A
- active site: S11 (= S10), K229 (= K243)
- binding glutamic acid: R7 (= R6), A9 (= A8), S11 (= S10), E43 (≠ D42), Y170 (= Y185), R188 (= R203), L192 (≠ H207)
- binding zinc ion: C99 (≠ A97), C101 (≠ E99), Y113 (= Y120), C117 (≠ A124)
P27305 Glutamyl-Q tRNA(Asp) synthetase; Glu-Q-RSs; EC 6.1.1.- from Escherichia coli (strain K12) (see paper)
31% identity, 55% coverage: 4:244/441 of query aligns to 17:242/308 of P27305
- E55 (≠ D42) binding
- Y182 (= Y185) binding
- R200 (= R203) binding
3aiiA Archaeal non-discriminating glutamyl-tRNA synthetase from methanothermobacter thermautotrophicus (see paper)
31% identity, 61% coverage: 3:273/441 of query aligns to 11:280/455 of 3aiiA
O13775 Probable glutamate--tRNA ligase, cytoplasmic; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
35% identity, 21% coverage: 3:95/441 of query aligns to 207:299/716 of O13775
Sites not aligning to the query:
- 190 modified: Phosphoserine
Query Sequence
>Ga0059261_2339 FitnessBrowser__Korea:Ga0059261_2339
MTVVTRFAPSPTGRLHVGNIRTALHNWMWARKQGGRFLLRIDDTDGERSREEHVLSIRDD
LAWLGLVPDGEARQSQRFDLYERRFAELAAAGRVYPAYETQQELDLKRKILLGRGLPPVY
DRAALALADADRARLEAEGVRPHWRFRLDHSAAIEWHDLIRGPQRFDPATMSDPVVRRAD
GSWLYLLPSVIDDIDMGITHVVRGEDHVSNTAAQLQMFDALGATPPAFAHEALLTGSEGK
LSKRLGSLGADHFRNAGIEPQAIVALLARLGTSDPVEPQADPAPLLATFDFARFGRAPAR
FDEAELAQLNARILHQLDYETVASRLPAGMDEAGWDAVRPNLSTLAEAADWWQVVEGPVD
AVRDPGDSAFLAQAAQAAAGLDWSDDPWHALTNALKDATGRKGKALFLPLRRALTGRDSG
PDMAALLPLIGRDRAIARLRG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory