SitesBLAST
Comparing Ga0059261_2412 FitnessBrowser__Korea:Ga0059261_2412 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q2G506 ATM1-type heavy metal exporter; ATP-binding cassette transporter Atm1; NaAtm1; EC 7.-.-.- from Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199) (see paper)
62% identity, 99% coverage: 1:596/602 of query aligns to 1:599/608 of Q2G506
- Y195 (= Y192) mutation to F: Strongly increases basal rate of ATP hydrolysis.
- N269 (= N266) mutation to A: Increases basal rate of ATP hydrolysis and abolishes stimulation of ATP hydrolysis by glutathione.
- NIAQ 269:272 (≠ NMGQ 266:269) binding
- Q272 (= Q269) mutation to A: Abolishes glutathione-dependent ATP hydrolysis.
- DMLG 316:319 (= DMLG 313:316) binding
- G319 (= G316) mutation to L: Abolishes glutathione-dependent ATP hydrolysis.
- E523 (= E520) mutation to Q: Abolishes transporter activity.
4mrvA Structure of a bacterial atm1-family abc transporter (see paper)
62% identity, 99% coverage: 3:596/602 of query aligns to 2:592/600 of 4mrvA
- binding mercury bis(L-gamma-glutamyl-3-sulfido-L-alanylglycine): Y149 (= Y153), L261 (= L265), N262 (= N266), Q265 (= Q269), D309 (= D313), M310 (= M314), L311 (= L315), G312 (= G316), M313 (≠ W317)
- binding phosphate ion: M313 (≠ W317), R316 (= R320), S389 (= S393), G392 (= G396), S394 (= S398)
4mrsA Structure of a bacterial atm1-family abc transporter (see paper)
62% identity, 99% coverage: 3:596/602 of query aligns to 2:592/600 of 4mrsA
- binding oxidized glutathione disulfide: K142 (= K146), Y149 (= Y153), R199 (= R203), R203 (= R207), L261 (= L265), N262 (= N266), Q265 (= Q269), D309 (= D313), M310 (= M314), G312 (= G316), M313 (≠ W317)
- binding phosphate ion: S389 (= S393), G392 (= G396), S394 (= S398)
4mrpA Structure of a bacterial atm1-family abc transporter (see paper)
62% identity, 99% coverage: 3:596/602 of query aligns to 2:592/600 of 4mrpA
- binding glutathione: Y149 (= Y153), L261 (= L265), N262 (= N266), Q265 (= Q269), D309 (= D313), M310 (= M314), M310 (= M314), L311 (= L315), G312 (= G316), M313 (≠ W317)
- binding phosphate ion: S389 (= S393), G390 (= G394), G392 (= G396), S394 (= S398)
4mrnA Structure of a bacterial atm1-family abc transporter (see paper)
62% identity, 99% coverage: 3:596/602 of query aligns to 2:592/600 of 4mrnA
6pamA Structure of a bacterial atm1-family abc transporter with mgadp bound (see paper)
63% identity, 96% coverage: 17:595/602 of query aligns to 7:586/586 of 6pamA
6parA Structure of a bacterial atm1-family abc exporter with mgamppnp bound (see paper)
63% identity, 96% coverage: 20:596/602 of query aligns to 1:578/578 of 6parA
- binding phosphoaminophosphonic acid-adenylate ester: Y349 (= Y367), R353 (= R371), I355 (= I373), S375 (= S393), G376 (= G394), G378 (= G396), K379 (= K397), S380 (= S398), T381 (= T399), K476 (= K494), S478 (= S496), G479 (= G497), G480 (= G498), E481 (= E499)
- binding magnesium ion: S380 (= S398), Q421 (= Q439)
6panA Structure of a bacterial atm1-family abc exporter with atp bound (see paper)
63% identity, 94% coverage: 33:596/602 of query aligns to 5:569/572 of 6panA
- binding adenosine-5'-triphosphate: Y340 (= Y367), R344 (= R371), I346 (= I373), S366 (= S393), G367 (= G394), K370 (= K397), S371 (= S398), T372 (= T399), K467 (= K494), S469 (= S496), G470 (= G497), E472 (= E499), H524 (= H551)
7n5aA Structure of atatm3 in the closed conformation (see paper)
46% identity, 96% coverage: 18:595/602 of query aligns to 8:589/589 of 7n5aA
7n59A Structure of atatm3 in the inward-facing conformation with gssg bound (see paper)
46% identity, 96% coverage: 18:595/602 of query aligns to 8:590/590 of 7n59A
Q9LVM1 ABC transporter B family member 25, mitochondrial; ABC transporter ABCB.25; AtABCB25; ABC transporter of the mitochondrion 3; AtATM3; Iron-sulfur clusters transporter ATM3; Protein STARIK 1 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
46% identity, 97% coverage: 18:602/602 of query aligns to 124:723/728 of Q9LVM1
- R612 (= R491) mutation to K: Resistant to sirtinol and reduced chlorophyll content.
H2LNR5 Iron-sulfur clusters transporter ABCB7, mitochondrial; ATP-binding cassette sub-family B member 7, mitochondrial from Oryzias latipes (Japanese rice fish) (Japanese killifish) (see paper)
46% identity, 96% coverage: 18:596/602 of query aligns to 114:704/746 of H2LNR5
- V222 (≠ T117) mutation to D: In namako (nmk) mutant. Nmk homozygous mutants exhibit steatosis and die several days after hatching. The liver of nmk mutant develops normally until the hatching stage (10 dpf) but by 2 dph, it exhibits a deformed morphology and loss of transparency. Hepatic cells are haphazardly arranged and contain a lot of vacuoles where neutral lipids are abnormally accumulated. Furthermore, mitochondoria in mutant livers tend to be enlarged and swollen.
Q9NP58 ATP-binding cassette sub-family B member 6; ABC-type heme transporter ABCB6; Mitochondrial ABC transporter 3; Mt-ABC transporter 3; P-glycoprotein-related protein; Ubiquitously-expressed mammalian ABC half transporter; EC 7.6.2.5 from Homo sapiens (Human) (see 11 papers)
46% identity, 97% coverage: 18:601/602 of query aligns to 246:833/842 of Q9NP58
- R276 (≠ K48) to W: may be a modifier of disease severity in porphyria patients; loss of expression; dbSNP:rs57467915
- Y286 (vs. gap) mutation to A: Loss of substrate-stimulate ATPase activity. Impairs protein expression.
- L356 (= L124) to P: in DUH3; the protein is retained in the Golgi apparatus; dbSNP:rs397514756
- N447 (≠ T215) mutation to Q: Does not affect N-glycosylation. Does not affect N-glycosylation; when associated with Q-498; Q-677 and Q-775. Does not affect trafficking from endoplasmic reticulum; when associated with Q-498; Q-677 and Q-775.
- A492 (≠ N260) to T: may be a modifier of disease severity in porphyria patients; increases expression; does not affect substrate binding; impairs ATP-binding; Loss of ATP-dependent coproporphyrin III transport; Highly decrease plasma membrane expression; dbSNP:rs147445258
- N498 (= N266) mutation to Q: Does not affect N-glycosylation. Does not affect N-glycosylation; when associated with Q-447; Q-677 and Q-775. Does not affect trafficking from endoplasmic reticulum; when associated with Q-447; Q-677 and Q-775.
- T521 (≠ S289) to S: may be a modifier of disease severity in porphyria patients; loss of expression; dbSNP:rs149363094
- V531 (= V299) mutation to A: Loss of substrate-stimulate ATPase activity. Impairs protein expression.
- M542 (≠ R310) mutation to A: Loss of substrate-stimulate ATPase activity.
- W546 (≠ M314) mutation to A: Loss of substrate-stimulate ATPase activity. Impairs protein expression.; mutation to F: Does not affect substrate-stimulate ATPase activity.; mutation to V: Loss of substrate-stimulate ATPase activity. Impairs protein expression.
- G579 (= G347) to E: in DUH3; the protein is retained in the Golgi apparatus. Does not affect subcellular location in early melanosome and lysosome. Does not rescue the normal amyloid fibril formation and normal maturation of pigmented melanosomes. Does not influence trafficking of melanosomal proteins.; dbSNP:rs397514758
- G588 (= G356) to S: may be a modifier of disease severity in porphyria patients; loss of expression; dbSNP:rs145526996
- Y599 (= Y367) binding
- 623:634 (vs. 391:402, 83% identical) binding
- K629 (= K397) mutation to A: Abolishes ATP hydrolysis. Abolishes coproporphyrin III transport.; mutation to M: Does not affect subcellular location in early melanosome and lysosome. Does not rescue the normal amyloid fibril formation and normal maturation of pigmented melanosomes. Does not influence trafficking of melanosomal proteins. Fails to rescue vacuolar sequestration of cadmium in Schizosaccharomyces pombe and Caenorhabditis elegans strains defective for HMT-1. Fails to rescue the cadmium tolerance in Schizosaccharomyces pombe and Caenorhabditis elegans strains defective for HMT-1. Does not rescue vacuolar cadmium levels in hmt-1 mutant S.pombe.
- N677 (= N445) mutation to Q: Does not affect N-glycosylation. Does not affect N-glycosylation; when associated with Q-447; Q-498; and Q-775. Does not affect trafficking from endoplasmic reticulum; when associated with Q-447; Q-498; and Q-775.
- A681 (≠ G449) to T: may be a modifier of disease severity in porphyria patients; loss of expression; dbSNP:rs142421126
- N775 (≠ G543) mutation to Q: Does not affect N-glycosylation. Does not affect N-glycosylation; when associated with Q-447; Q-498 and Q-677. Does not affect trafficking from endoplasmic reticulum; when associated with Q-447; Q-498 and Q-677.
- L811 (= L579) to V: in MCOPCB7; hypomorphic mutation; dbSNP:rs387906910
Sites not aligning to the query:
- 1:205 Required for the lysosomal targeting
- 1:236 Required for ATPase activity
- 6 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→Q: Loss of N-glycosylation. Loss of N-glycosylation; when associated with Q-447; Q-498; Q-677 and Q-775. Does not affect substrate binding.
- 8 modified: Disulfide link with 26; C→G: Loss of N-glycosylation.; C→S: Does not affect substrate binding. Does not affect N-glycosylation. Impairs endoplasmic reticulum exit. Impairs endoplasmic reticulum exit; when associated with C-8. Increases ABCB6 proteasomal degradation. Affects protein stability. Does not affect migration in the presence of DTT; when associated with A-50 and A-120.
- 26 modified: Disulfide link with 8; C→A: Decreases protein expression. Affects protein stability. Loss of ability to stimulate porphyrin synthesis.; C→S: Decreases protein expression. Impairs endoplasmic reticulum exit; when associated with C-8. Affects protein stability.
- 50 C→A: Increases migration in the absence of DTT; when associated with A-120. Reduces migration in with the presence of DTT; when associated with A-120.
- 57 A → T: in MCOPCB7; uncertain significance; hypomorphic mutation; dbSNP:rs387906911
- 69 R → G: in a breast cancer sample; somatic mutation
- 120 C→A: Increases migration in the absence of DTT; when associated with A-50. Reduces migration in with the presence of DTT; when associated with A-50.
- 170 S → G: in DUH3; the protein is retained in the Golgi apparatus; dbSNP:rs397514757
- 192 R → Q: decrease expression; does not affect substrate binding; does not affect ATP-binding; loss of plasma membrane expression; dbSNP:rs150221689
8k7bA Post-occluded structure of human abcb6 w546a mutant (adp/vo4-bound) (see paper)
46% identity, 96% coverage: 18:595/602 of query aligns to 9:590/590 of 8k7bA
- binding adp orthovanadate: Y362 (= Y367), G389 (= G394), G391 (= G396), K392 (= K397), S393 (= S398), T394 (= T399), K489 (= K494), L490 (= L495), S491 (= S496), G492 (= G497), H546 (= H551)
- binding magnesium ion: S393 (= S398), Q434 (= Q439)
7dnzB Cryo-em structure of the human abcb6 (hemin and gsh-bound) (see paper)
46% identity, 96% coverage: 18:594/602 of query aligns to 11:591/591 of 7dnzB
- binding glutathione: E111 (≠ A114), L135 (≠ T138), D139 (≠ E142), R204 (= R207), N310 (≠ D313), T314 (≠ W317), R317 (= R320)
- binding protoporphyrin ix containing fe: T85 (≠ Y84), W311 (≠ M314)
- binding cholesterol hemisuccinate: M37 (≠ V44), A42 (≠ V49), W177 (= W180), I181 (≠ S184), L184 (≠ A187), L280 (≠ V283)
7dnzA Cryo-em structure of the human abcb6 (hemin and gsh-bound) (see paper)
46% identity, 96% coverage: 18:594/602 of query aligns to 11:591/591 of 7dnzA
7eklA Mitochondrial outer membrane protein (see paper)
46% identity, 96% coverage: 18:595/602 of query aligns to 9:590/590 of 7eklA
- binding adenosine-5'-triphosphate: Y362 (= Y367), R366 (= R371), G389 (= G394), A390 (= A395), G391 (= G396), K392 (= K397), S393 (= S398), F475 (≠ M480), K489 (= K494), L490 (= L495), S491 (= S496), E494 (= E499), H546 (= H551)
- binding magnesium ion: S393 (= S398), Q434 (= Q439)
Q9DC29 ATP-binding cassette sub-family B member 6; ABC-type heme transporter ABCB6; EC 7.6.2.5 from Mus musculus (Mouse) (see paper)
46% identity, 98% coverage: 12:600/602 of query aligns to 240:832/842 of Q9DC29
- L356 (= L124) mutation to P: Results in retention of the protein in the Golgi apparatus.
- G579 (= G347) mutation to E: Results in retention of the protein in the Golgi apparatus.
Sites not aligning to the query:
- 170 S→G: Results in retention of the protein in the Golgi apparatus.
7dnyB Cryo-em structure of the human abcb6 (coproporphyrin iii-bound) (see paper)
46% identity, 95% coverage: 26:596/602 of query aligns to 1:575/575 of 7dnyB
- binding coproporphyrin III: W293 (≠ M314), Y297 (≠ V318)
- binding cholesterol hemisuccinate: M19 (≠ V44), R23 (≠ K48), A24 (≠ V49), I31 (≠ A56), R34 (vs. gap), W51 (≠ L68), T54 (≠ R71), F58 (≠ T75), Y151 (≠ I172), F155 (≠ K176)
O75027 Iron-sulfur clusters transporter ABCB7, mitochondrial; ATP-binding cassette sub-family B member 7, mitochondrial; ATP-binding cassette transporter 7; ABC transporter 7 protein from Homo sapiens (Human) (see 4 papers)
45% identity, 96% coverage: 18:595/602 of query aligns to 121:710/752 of O75027
- R315 (= R203) natural variant: R -> G
- F346 (= F234) natural variant: F -> I
- E433 (≠ T321) to K: in ASAT; impaired maturation of cytosolic Fe/S proteins, loss of the ability to couple MgATP binding with stimulation of ATPase activity at the nucleotide binding domain;; loss of [2Fe-2S]-(GS)4 cluster transport; dbSNP:rs80356714; mutation to D: Significantly increases ATPase activity by [2Fe-2S]-(GS)4 cluster stimulation. Increases affinity for Mg-ATP. Does not affect affinity for Mg-ATP in the presence of the in the presence of [2Fe-2S]-(GS)4 cluster. Does not affect [2Fe-2S]-(GS)4 cluster transport.; mutation to K: Loss of ATPase activity stimulation by [2Fe-2S]-(GS)4 cluster stimulation. Loss of the ability to couple MgATP binding with stimulation of ATPase activity at the nucleotide binding domain. Loss of [2Fe-2S]-(GS)4 cluster transport.; mutation to Q: Loss of ATPase activity stimulation by [2Fe-2S]-(GS)4 cluster stimulation. Loss of the ability to couple MgATP binding with stimulation of ATPase activity at the nucleotide binding domain. Loss of [2Fe-2S]-(GS)4 cluster transport.
Query Sequence
>Ga0059261_2412 FitnessBrowser__Korea:Ga0059261_2412
MPPQTASTGGERPLFATLRRFLPYLWPAGMPGLKARIIGALLLVLLSKVVQVYGAAYALK
AAVDSMALNDRSVVTFVILMVVGYAAARLFTTLFDNLRNTVFEKVGQDATRRLAIVTFRH
LHQLSLRFHLERRTGAVTKVVERGTKSIDSMLYFLLFNIAPTILELALVLQIFGSKFGWW
LVASTMAMVVIYIAFTRWITDWRSKLREQMNDLDTGAVAHAVDSLLNFETVKYFNAEARE
ADRYAKAVDAYAKAAVKSENSLAWLNMGQSLITNVMLGAGMAVVAWGWSSGEFTAGDVVF
VSTLLSQLFRPLDMLGWVYRTIRQGVIDMGAMFDLIDTDAEVKDVAGAPALQVTRGEVRF
EGVRFGYEANRDILKGIDLVIAPGQTVAVVGPSGAGKSTLARILYRFYDLTGGRVTIDGQ
DIAQVTQGSLRAAIGIVPQDTVLFNDTVGYNIAYGREGATADQVAAAARGAAIAGFIESM
PDGYDTRVGERGLKLSGGEKQRVAIARTLLKDPPILILDEATSALDSRTEAEILDTLEAI
ERGRTTIVIAHRLSTVVNADRIVVLEAGRIAEQGTHAQLLELRGVYAEMWARQQAEREAI
EA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory