SitesBLAST
Comparing Ga0059261_2444 FitnessBrowser__Korea:Ga0059261_2444 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P18079 5-aminolevulinate synthase; 5-aminolevulinic acid synthase; Delta-ALA synthase; Delta-aminolevulinate synthase; EC 2.3.1.37 from Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) (see paper)
59% identity, 98% coverage: 10:412/413 of query aligns to 1:405/409 of P18079
- R21 (= R30) binding
- S137 (= S146) binding
- K156 (= K165) binding
- S189 (= S198) binding in other chain
- H217 (= H226) binding in other chain
- T245 (= T254) binding in other chain
- K248 (= K257) active site
- S277 (≠ T286) binding
- T278 (= T287) binding
- T365 (= T372) binding
2bwoB 5-aminolevulinate synthase from rhodobacter capsulatus in complex with succinyl-coa (see paper)
59% identity, 96% coverage: 10:406/413 of query aligns to 1:399/399 of 2bwoB
- active site: N54 (= N63), H142 (= H151), E185 (= E194), S189 (= S198), D214 (= D223), H217 (= H226), K248 (= K257)
- binding pyridoxal-5'-phosphate: S114 (= S123), A115 (≠ G124), Y116 (= Y125), H142 (= H151), E185 (= E194), S189 (= S198), D214 (= D223), V216 (= V225), H217 (= H226), T245 (= T254), K248 (= K257)
- binding succinyl-coenzyme a: R21 (= R30), T83 (= T92), N85 (= N94), S137 (= S146), S139 (≠ E148), H142 (= H151), I146 (= I155), K150 (≠ R159), K156 (= K165), I158 (≠ V167), F276 (= F285), F363 (≠ Y370), P364 (= P371), T365 (= T372)
2bwpA 5-aminolevulinate synthase from rhodobacter capsulatus in complex with glycine (see paper)
59% identity, 96% coverage: 10:404/413 of query aligns to 1:397/398 of 2bwpA
- active site: N54 (= N63), H142 (= H151), E185 (= E194), S189 (= S198), D214 (= D223), H217 (= H226), K248 (= K257)
- binding n-glycine-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-yl-methane]: N54 (= N63), A115 (≠ G124), Y116 (= Y125), H142 (= H151), E185 (= E194), D214 (= D223), V216 (= V225), H217 (= H226), T245 (= T254), K248 (= K257), S277 (≠ T286), T278 (= T287)
P08680 5-aminolevulinate synthase, erythroid-specific, mitochondrial; ALAS-E; 5-aminolevulinic acid synthase 2; Delta-ALA synthase 2; Delta-aminolevulinate synthase 2; EC 2.3.1.37 from Mus musculus (Mouse) (see 2 papers)
50% identity, 98% coverage: 5:409/413 of query aligns to 138:545/587 of P08680
- K391 (= K257) modified: N6-(pyridoxal phosphate)lysine; mutation K->A,H: Abolishes enzyme activity.
Sites not aligning to the query:
- 1:49 modified: transit peptide, Mitochondrion
P22557 5-aminolevulinate synthase, erythroid-specific, mitochondrial; ALAS-E; 5-aminolevulinic acid synthase 2; Delta-ALA synthase 2; Delta-aminolevulinate synthase 2; EC 2.3.1.37 from Homo sapiens (Human) (see 11 papers)
50% identity, 95% coverage: 12:404/413 of query aligns to 145:540/587 of P22557
- K156 (≠ L23) to E: in SIDBA1; significantly reduced activity
- R170 (= R37) to H: in SIDBA1; significantly increased thermosensitivity
- R204 (≠ Q70) to Q: in SIDBA1; 15% to 35% activity of wild-type; dbSNP:rs1338391423
- R218 (≠ D84) to H: in SIDBA1; significantly increased thermosensitivity; dbSNP:rs185504937
- E242 (= E108) to K: in SIDBA1; significantly reduced activity
- C258 (≠ G124) binding in other chain
- F259 (≠ Y125) binding in other chain
- D263 (≠ E129) to N: in SIDBA1; significantly reduced activity
- P339 (= P205) to L: in SIDBA1; significantly reduced activity
- H360 (= H226) binding in other chain
- R375 (= R241) to C: in SIDBA1; significantly reduced activity
- T388 (= T254) binding in other chain
- K391 (= K257) modified: N6-(pyridoxal phosphate)lysine
- R411 (= R277) to C: in SIDBA1; 12% to 25% activity of wild-type; dbSNP:rs137852305; to H: in SIDBA1; significantly reduced activity
- T420 (= T286) binding
- T421 (= T287) binding
- R452 (≠ A316) to G: in SIDBA1; does not affect activity
- R511 (= R375) mutation to E: 2-fold increased enzyme activity with a lower specificity for glycine and higher for succinyl-CoA.
- P520 (= P384) to L: in SIDBA1; likely benign; associated in cis with H-560 in a patient; dbSNP:rs201062903
Sites not aligning to the query:
- 1:49 modified: transit peptide, Mitochondrion
- 560 R → H: in SIDBA1; associated in cis with L-520 in a patient; dbSNP:rs892041887
- 572 R → H: in SIDBA1; does not affect activity
- 586 Y → F: rare variant found in a congenital erythropoietic porphyria patient that also carries UROS mutations R-73 and Q-248; increased enzyme activity; dbSNP:rs139596860
5qrdB Pandda analysis group deposition -- crystal structure of human alas2a in complex with z1328968520
50% identity, 95% coverage: 12:404/413 of query aligns to 9:399/428 of 5qrdB
- binding pyridoxal-5'-phosphate: S116 (= S123), C117 (≠ G124), F118 (≠ Y125), N121 (= N128), H144 (= H151), E187 (= E194), D216 (= D223), V218 (= V225), H219 (= H226), T247 (= T254), K250 (= K257), T279 (= T286), T280 (= T287)
Sites not aligning to the query:
5qrbB Pandda analysis group deposition -- crystal structure of human alas2a in complex with z2856434868
50% identity, 95% coverage: 12:404/413 of query aligns to 9:399/428 of 5qrbB
- binding 1-ethyl-N-(2-fluorophenyl)piperidin-4-amine: W35 (≠ N38), A38 (≠ M41), F41 (≠ N44), D49 (≠ P56)
- binding pyridoxal-5'-phosphate: S116 (= S123), C117 (≠ G124), F118 (≠ Y125), H144 (= H151), E187 (= E194), S191 (= S198), D216 (= D223), V218 (= V225), H219 (= H226), T247 (= T254), K250 (= K257), T279 (= T286), T280 (= T287)
5qr8B Pandda analysis group deposition -- crystal structure of human alas2a in complex with z57258487
50% identity, 95% coverage: 12:404/413 of query aligns to 9:399/428 of 5qr8B
- binding N-{[4-(dimethylamino)phenyl]methyl}-4H-1,2,4-triazol-4-amine: D10 (≠ S13)
- binding pyridoxal-5'-phosphate: C117 (≠ G124), F118 (≠ Y125), H144 (= H151), E187 (= E194), S191 (= S198), D216 (= D223), V218 (= V225), H219 (= H226), T247 (= T254), K250 (= K257), T279 (= T286), T280 (= T287)
Sites not aligning to the query:
5qr7B Pandda analysis group deposition -- crystal structure of human alas2a in complex with z57299529
50% identity, 95% coverage: 12:404/413 of query aligns to 9:399/428 of 5qr7B
- binding ~{N}-(2-phenylethyl)-1~{H}-benzimidazol-2-amine: W35 (≠ N38), A38 (≠ M41), F41 (≠ N44), D49 (≠ P56), H207 (≠ D214), L212 (= L219), H239 (≠ S246), D242 (≠ T249), T262 (≠ D269)
- binding pyridoxal-5'-phosphate: C117 (≠ G124), F118 (≠ Y125), H144 (= H151), E187 (= E194), D216 (= D223), V218 (= V225), H219 (= H226), K250 (= K257), T279 (= T286), T280 (= T287)
5qr5B Pandda analysis group deposition -- crystal structure of human alas2a in complex with z2241115980
50% identity, 95% coverage: 12:404/413 of query aligns to 9:399/428 of 5qr5B
- binding 1-[(furan-2-yl)methyl]-4-(methylsulfonyl)piperazine: W35 (≠ N38), F41 (≠ N44), D49 (≠ P56)
- binding pyridoxal-5'-phosphate: S116 (= S123), C117 (≠ G124), F118 (≠ Y125), N121 (= N128), H144 (= H151), E187 (= E194), S191 (= S198), D216 (= D223), V218 (= V225), H219 (= H226), K250 (= K257), T279 (= T286), T280 (= T287)
5qr4B Pandda analysis group deposition -- crystal structure of human alas2a in complex with z2856434826
50% identity, 95% coverage: 12:404/413 of query aligns to 9:399/428 of 5qr4B
- binding [4-(propan-2-yl)piperazin-1-yl](thiophen-2-yl)methanone: W35 (≠ N38), D37 (≠ G40), A38 (≠ M41), F41 (≠ N44)
- binding pyridoxal-5'-phosphate: C117 (≠ G124), F118 (≠ Y125), N121 (= N128), H144 (= H151), E187 (= E194), S191 (= S198), D216 (= D223), V218 (= V225), H219 (= H226), T247 (= T254), K250 (= K257), T279 (= T286), T280 (= T287)
5qqzB Pandda analysis group deposition -- crystal structure of human alas2a in complex with z1675346324
50% identity, 95% coverage: 12:404/413 of query aligns to 9:399/428 of 5qqzB
- binding trans-3-[(2,6-dimethylpyrimidin-4-yl)(methyl)amino]cyclobutan-1-ol: W35 (≠ N38), D49 (≠ P56)
- binding pyridoxal-5'-phosphate: C117 (≠ G124), F118 (≠ Y125), N121 (= N128), H144 (= H151), E187 (= E194), D216 (= D223), V218 (= V225), H219 (= H226), K250 (= K257), T279 (= T286), T280 (= T287)
5qqrB Pandda analysis group deposition -- crystal structure of human alas2a in complex with z1171217421
50% identity, 95% coverage: 12:404/413 of query aligns to 9:399/429 of 5qqrB
- binding pyridoxal-5'-phosphate: S116 (= S123), C117 (≠ G124), F118 (≠ Y125), H144 (= H151), E187 (= E194), S191 (= S198), D216 (= D223), V218 (= V225), H219 (= H226), T247 (= T254), K250 (= K257), T279 (= T286), T280 (= T287)
Sites not aligning to the query:
6hrhA Structure of human erythroid-specific 5'-aminolevulinate synthase, alas2
50% identity, 95% coverage: 12:404/413 of query aligns to 9:398/429 of 6hrhA
- binding pyridoxal-5'-phosphate: S115 (= S123), C116 (≠ G124), F117 (≠ Y125), H143 (= H151), E186 (= E194), S190 (= S198), D215 (= D223), H218 (= H226), T246 (= T254), K249 (= K257), T278 (= T286), T279 (= T287)
5qreA Pandda analysis group deposition -- crystal structure of human alas2a in complex with z117233350
50% identity, 95% coverage: 12:404/413 of query aligns to 9:398/429 of 5qreA
- binding pyridoxal-5'-phosphate: C116 (≠ G124), F117 (≠ Y125), H143 (= H151), E186 (= E194), S190 (= S198), D215 (= D223), V217 (= V225), H218 (= H226), T246 (= T254), K249 (= K257), T278 (= T286), T279 (= T287)
Sites not aligning to the query:
5qrcA Pandda analysis group deposition -- crystal structure of human alas2a in complex with z31721798
50% identity, 95% coverage: 12:404/413 of query aligns to 9:398/429 of 5qrcA
- binding 3-cyclohexyl-1-(morpholin-4-yl)propan-1-one: K129 (= K137), I130 (≠ V138), Y271 (= Y279)
- binding pyridoxal-5'-phosphate: S115 (= S123), C116 (≠ G124), F117 (≠ Y125), H143 (= H151), E186 (= E194), S190 (= S198), D215 (= D223), V217 (= V225), H218 (= H226), K249 (= K257), T278 (= T286), T279 (= T287)
5qraA Pandda analysis group deposition -- crystal structure of human alas2a in complex with z1101755952
50% identity, 95% coverage: 12:404/413 of query aligns to 9:398/429 of 5qraA
- binding [(4R)-4-methyl-2,3,4,5-tetrahydro-1H-azepin-1-yl](1,3-thiazol-4-yl)methanone: K129 (= K137), I130 (≠ V138), Y271 (= Y279)
- binding pyridoxal-5'-phosphate: S115 (= S123), C116 (≠ G124), F117 (≠ Y125), H143 (= H151), E186 (= E194), S190 (= S198), D215 (= D223), V217 (= V225), H218 (= H226), T246 (= T254), K249 (= K257), T278 (= T286), T279 (= T287)
5qr9A Pandda analysis group deposition -- crystal structure of human alas2a in complex with z31478129
50% identity, 95% coverage: 12:404/413 of query aligns to 9:398/429 of 5qr9A
- binding ethyl benzylcarbamate: H206 (≠ D214), L211 (= L219), D241 (≠ T249)
- binding pyridoxal-5'-phosphate: S115 (= S123), C116 (≠ G124), F117 (≠ Y125), H143 (= H151), E186 (= E194), S190 (= S198), D215 (= D223), V217 (= V225), H218 (= H226), K249 (= K257), T278 (= T286), T279 (= T287)
5qr3A Pandda analysis group deposition -- crystal structure of human alas2a in complex with z915492990
50% identity, 95% coverage: 12:404/413 of query aligns to 9:398/429 of 5qr3A
- binding pyridoxal-5'-phosphate: S115 (= S123), C116 (≠ G124), F117 (≠ Y125), H143 (= H151), E186 (= E194), S190 (= S198), D215 (= D223), V217 (= V225), H218 (= H226), K249 (= K257), T278 (= T286), T279 (= T287)
Sites not aligning to the query:
5qr1A Pandda analysis group deposition -- crystal structure of human alas2a in complex with z396380540
50% identity, 95% coverage: 12:404/413 of query aligns to 9:398/429 of 5qr1A
- binding ~{N}-(cyclobutylmethyl)-1,5-dimethyl-pyrazole-4-carboxamide: I130 (≠ V138), Y271 (= Y279)
- binding pyridoxal-5'-phosphate: S115 (= S123), C116 (≠ G124), F117 (≠ Y125), H143 (= H151), E186 (= E194), S190 (= S198), D215 (= D223), V217 (= V225), H218 (= H226), T246 (= T254), K249 (= K257), T278 (= T286), T279 (= T287)
Query Sequence
>Ga0059261_2444 FitnessBrowser__Korea:Ga0059261_2444
MSTDTTPRAVDYSRVFTQAIDRLHAEGRYRVFIDILRNKGMFPNARCFHGHNGPKPITVW
CSNDYLAMGQHPKVIAAMEEALHDVGAGSGGTRNIGGNTHYHVDLEGELADLHGKQGALL
FTSGYVSNEATLSTLAKVLPGCIIYSDELNHASMIAGIRNSGCEKRVWRHNDITHLEELL
AADDPTAPKLIAFESIYSMDGDVAPIHAICDLADKYNALTYLDEVHAVGMYGARGGGISE
RDEAASRLTIIEGTLGKAFGVMGGYIAADQTIIDVIRSYAPGFIFTTSLSPVLVAGVLAS
VRHLKQSSTERDGQQAAAARLKAMMADAGLPVMNTTTHIVPLMVGDPVKAKRISDILLAE
YGMYVQPINYPTVPRGTERLRFTPGPAHDEAMMRDLTAALVEIWERLELRAAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory