Comparing Ga0059261_2514 FitnessBrowser__Korea:Ga0059261_2514 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 19 hits to proteins with known functional sites (download)
P08839 Phosphoenolpyruvate-protein phosphotransferase; Phosphotransferase system, enzyme I; EC 2.7.3.9 from Escherichia coli (strain K12) (see 2 papers)
31% identity, 72% coverage: 185:730/759 of query aligns to 2:549/575 of P08839
2hwgA Structure of phosphorylated enzyme i of the phosphoenolpyruvate:sugar phosphotransferase system (see paper)
31% identity, 72% coverage: 185:730/759 of query aligns to 1:548/572 of 2hwgA
P23533 Phosphoenolpyruvate-protein phosphotransferase; Phosphotransferase system, enzyme I; EC 2.7.3.9 from Staphylococcus carnosus (strain TM300) (see paper)
30% identity, 72% coverage: 184:728/759 of query aligns to 4:546/573 of P23533
2wqdA Crystal structure of enzyme i of the phosphoenolpyruvate:sugar phosphotransferase system in the dephosphorylated state (see paper)
29% identity, 71% coverage: 189:728/759 of query aligns to 2:546/570 of 2wqdA
2xz7A Crystal structure of the phosphoenolpyruvate-binding domain of enzyme i in complex with phosphoenolpyruvate from the thermoanaerobacter tengcongensis pep-sugar phosphotransferase system (pts) (see paper)
41% identity, 39% coverage: 436:730/759 of query aligns to 8:301/324 of 2xz7A
2xz9A Crystal structure from the phosphoenolpyruvate-binding domain of enzyme i in complex with pyruvate from the thermoanaerobacter tengcongensis pep-sugar phosphotransferase system (pts) (see paper)
41% identity, 39% coverage: 436:730/759 of query aligns to 1:294/317 of 2xz9A
5lu4A C4-type pyruvate phosphate dikinase: conformational intermediate of central domain in the swiveling mechanism (see paper)
27% identity, 47% coverage: 358:716/759 of query aligns to 445:842/850 of 5lu4A
Sites not aligning to the query:
5jvjB C4-type pyruvate phosphate dikinase: different conformational states of the nucleotide binding domain in the dimer (see paper)
27% identity, 47% coverage: 358:716/759 of query aligns to 372:787/797 of 5jvjB
Sites not aligning to the query:
Q39735 Pyruvate, phosphate dikinase, chloroplastic; Cold-sensitive pyruvate, orthophosphate dikinase; Pyruvate, orthophosphate dikinase; EC 2.7.9.1 from Flaveria bidentis (Coastal plain yellowtops) (Ethulia bidentis) (see 2 papers)
26% identity, 47% coverage: 358:716/759 of query aligns to 524:943/953 of Q39735
Sites not aligning to the query:
5jvlA C4-type pyruvate phospate dikinase: nucleotide binding domain with bound atp analogue (see paper)
26% identity, 47% coverage: 358:716/759 of query aligns to 445:864/874 of 5jvlA
Sites not aligning to the query:
O23404 Pyruvate, phosphate dikinase 1, chloroplastic; Pyruvate, orthophosphate dikinase 1; EC 2.7.9.1 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
26% identity, 47% coverage: 357:716/759 of query aligns to 533:952/963 of O23404
1vbgA Pyruvate phosphate dikinase from maize (see paper)
26% identity, 47% coverage: 358:716/759 of query aligns to 445:864/874 of 1vbgA
Sites not aligning to the query:
5jvlB C4-type pyruvate phospate dikinase: nucleotide binding domain with bound atp analogue (see paper)
26% identity, 45% coverage: 366:710/759 of query aligns to 122:505/520 of 5jvlB
Sites not aligning to the query:
P11155 Pyruvate, phosphate dikinase 1, chloroplastic; Pyruvate, orthophosphate dikinase 1; EC 2.7.9.1 from Zea mays (Maize) (see 7 papers)
26% identity, 47% coverage: 358:710/759 of query aligns to 518:932/947 of P11155
Sites not aligning to the query:
P22983 Pyruvate, phosphate dikinase; Pyruvate, orthophosphate dikinase; EC 2.7.9.1 from Clostridium symbiosum (Bacteroides symbiosus) (see 4 papers)
25% identity, 47% coverage: 357:716/759 of query aligns to 443:861/874 of P22983
Sites not aligning to the query:
1kc7A Pyruvate phosphate dikinase with bound mg-phosphonopyruvate (see paper)
25% identity, 47% coverage: 357:716/759 of query aligns to 442:860/872 of 1kc7A
Sites not aligning to the query:
1vbhA Pyruvate phosphate dikinase with bound mg-pep from maize (see paper)
26% identity, 46% coverage: 366:716/759 of query aligns to 441:852/862 of 1vbhA
Sites not aligning to the query:
Q02KR1 Phosphoenolpyruvate synthase; PEP synthase; Pyruvate, water dikinase; EC 2.7.9.2 from Pseudomonas aeruginosa (strain UCBPP-PA14) (see paper)
24% identity, 47% coverage: 354:713/759 of query aligns to 403:777/791 of Q02KR1
P37349 PEP-dependent dihydroxyacetone kinase, phosphoryl donor subunit DhaM; Dihydroxyacetone kinase subunit M; EC 2.7.1.121 from Escherichia coli (strain K12) (see paper)
25% identity, 28% coverage: 196:409/759 of query aligns to 257:461/472 of P37349
Sites not aligning to the query:
>Ga0059261_2514 FitnessBrowser__Korea:Ga0059261_2514
MPVSAAASAREILTRLHDVMASRAAAQGKLNSVVNIIGEALNSEVCSIYLLREGALELFA
TRGLAQEAVHVTKLAMGEGLTGTIAANVETLNLDEAAAHPDFAYRPETGEDRFHSYAGVP
IIRKERAVGVLAVQHADPRKYDEVEIEALQTVAMVLSELIANAGLIDPAGGGGTTRLQST
GTARVPGFKLVEGMAAGAAVFHQPRIIIEHTVAEDIEAERHRVYAAFDKMREQIDRMTSQ
AEFGGGGEHEEVLETYKMFAYDEGWSRRINEAIDSGLTAEAAIERVQQRTRMRMRQIDDP
LLRDRMHDLEDLSNRLLRIVSGQLGTAAQLGLRQDSILIARNLGPAELLEYDRRRLKGVV
LEEGSLTAHVTIVARAMGVPVLGRVKDIRRLIAEGDRLLVDVTEDTLIIRPTAAMDEAFE
AKLLVTQKRRAAFAALKNEAPVTTDGHRLTVMVNAGLRDDVAALDLTGADGIGLFRTEFQ
FLVSATLPQRDSQRRLYKDVLDAAGDRPVTFRTVDIGGDKALPYLDHDENGEEENPAMGW
RALRLALDREGLMKVQARALLEAAAGRTLNVMFPMVSEPWEFDEARTLFETQRAWLESRG
HKLPLHIRYGAMLEVPALAEVLDLLLPRLDFLSVGTNDLTQFLFAADRAHPKLAVRYDWL
SPSILRFLRRVTAEAAEADVPLAVCGEMGGRPLEAMALIGLGIDRLSITPAAVGPIKAMV
RSLDRAKLIAAMRGMLDRPPQDMRAALEQWAADHGVELA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory