Comparing Ga0059261_2542 Ga0059261_2542 ABC-type (unclassified) transport system, ATPase component to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
55% identity, 92% coverage: 22:258/258 of query aligns to 3:240/240 of 6mjpA
6mbnA Lptb e163q in complex with atp (see paper)
54% identity, 93% coverage: 19:258/258 of query aligns to 1:241/241 of 6mbnA
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
55% identity, 91% coverage: 22:256/258 of query aligns to 3:238/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
55% identity, 91% coverage: 22:256/258 of query aligns to 3:238/238 of 6s8gA
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
55% identity, 90% coverage: 22:253/258 of query aligns to 3:235/235 of 6mhzA
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
55% identity, 90% coverage: 22:252/258 of query aligns to 3:234/234 of 6b89A
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
55% identity, 90% coverage: 22:252/258 of query aligns to 3:234/234 of 4p31A
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
54% identity, 89% coverage: 22:251/258 of query aligns to 3:233/233 of 6b8bA
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
31% identity, 89% coverage: 26:254/258 of query aligns to 9:254/254 of 1g6hA
3d31A Modbc from methanosarcina acetivorans (see paper)
33% identity, 85% coverage: 22:241/258 of query aligns to 2:215/348 of 3d31A
Sites not aligning to the query:
3fvqB Crystal structure of the nucleotide binding domain fbpc complexed with atp (see paper)
36% identity, 92% coverage: 19:255/258 of query aligns to 1:241/350 of 3fvqB
6z5uK Cryo-em structure of the a. Baumannii mlabdef complex bound to appnhp (see paper)
32% identity, 87% coverage: 22:246/258 of query aligns to 3:231/253 of 6z5uK
7d0aB Acinetobacter mlafedb complex in adp-vanadate trapped vclose conformation (see paper)
32% identity, 87% coverage: 22:246/258 of query aligns to 5:233/263 of 7d0aB
7d08B Acinetobacter mlafedb complex in atp-bound vtrans1 conformation (see paper)
32% identity, 87% coverage: 22:246/258 of query aligns to 5:233/263 of 7d08B
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
31% identity, 88% coverage: 26:253/258 of query aligns to 9:253/253 of 1g9xB
4yerA Crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution
33% identity, 85% coverage: 22:241/258 of query aligns to 5:223/285 of 4yerA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
30% identity, 88% coverage: 22:249/258 of query aligns to 2:231/240 of 4ymuJ
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
29% identity, 90% coverage: 22:253/258 of query aligns to 7:238/240 of 1ji0A
5x40A Structure of a cbio dimer bound with amppcp (see paper)
35% identity, 81% coverage: 37:244/258 of query aligns to 21:230/280 of 5x40A
Sites not aligning to the query:
8f5bA Human abca4 structure in complex with amp-pnp
31% identity, 84% coverage: 21:238/258 of query aligns to 720:936/1924 of 8f5bA
Sites not aligning to the query:
>Ga0059261_2542 Ga0059261_2542 ABC-type (unclassified) transport system, ATPase component
MADIETLEPVAAEAGTPPTSGLAVVSIAKSYDKRVVLSDVSLSVGKGEVVGLLGPNGAGK
TTCFYSVMGLVKPDAGRIMLDGVDITPLPMYRRAILGLGYLPQETSIFRGLTVAKNISAV
LELSEPDKSARAARLDQLLEEFGLTRLRDAPAMALSGGERRRAEIARALAADPSIMLLDE
PFAGIDPISIADIRDLVKELKTRNIGVLITDHNVRETLDIVDRASIIYDGRVLFAGSPED
LVADANVRRLYLGEGFSL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory