Comparing Ga0059261_2545 FitnessBrowser__Korea:Ga0059261_2545 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3ijpB Crystal structure of dihydrodipicolinate reductase from bartonella henselae at 2.0a resolution (see paper)
52% identity, 86% coverage: 36:242/242 of query aligns to 60:266/267 of 3ijpB
Sites not aligning to the query:
3ijpA Crystal structure of dihydrodipicolinate reductase from bartonella henselae at 2.0a resolution (see paper)
52% identity, 86% coverage: 36:242/242 of query aligns to 60:266/266 of 3ijpA
Sites not aligning to the query:
5temA Structure of 4-hydroxy-tetrahydrodipicolinate reductase from vibrio vulnificus with 2,6 pyridine dicarboxylic and nadh (see paper)
44% identity, 96% coverage: 11:242/242 of query aligns to 52:266/266 of 5temA
Sites not aligning to the query:
5tejB Structure of 4-hydroxy-tetrahydrodipicolinate reductase from vibrio vulnificus with 2,5 furan dicarboxylic and nadh (see paper)
44% identity, 96% coverage: 11:242/242 of query aligns to 52:266/269 of 5tejB
Sites not aligning to the query:
5tejA Structure of 4-hydroxy-tetrahydrodipicolinate reductase from vibrio vulnificus with 2,5 furan dicarboxylic and nadh (see paper)
44% identity, 96% coverage: 11:242/242 of query aligns to 52:266/269 of 5tejA
Sites not aligning to the query:
4ywjA Crystal structure of 4-hydroxy-tetrahydrodipicolinate reductase (htpa reductase) from pseudomonas aeruginosa
43% identity, 100% coverage: 1:242/242 of query aligns to 1:267/268 of 4ywjA
P04036 4-hydroxy-tetrahydrodipicolinate reductase; HTPA reductase; EC 1.17.1.8 from Escherichia coli (strain K12) (see 3 papers)
47% identity, 81% coverage: 46:242/242 of query aligns to 74:270/273 of P04036
Sites not aligning to the query:
1drwA Escherichia coli dhpr/nhdh complex (see paper)
47% identity, 81% coverage: 46:242/242 of query aligns to 73:269/272 of 1drwA
Sites not aligning to the query:
1dihA Three-dimensional structure of e. Coli dihydrodipicolinate reductase (see paper)
47% identity, 81% coverage: 46:242/242 of query aligns to 73:269/272 of 1dihA
Sites not aligning to the query:
1arzB Escherichia coli dihydrodipicolinate reductase in complex with nadh and 2,6 pyridine dicarboxylate (see paper)
47% identity, 81% coverage: 46:242/242 of query aligns to 70:266/269 of 1arzB
Sites not aligning to the query:
1drvA Escherichia coli dhpr/acnadh complex (see paper)
47% identity, 81% coverage: 46:242/242 of query aligns to 71:267/270 of 1drvA
Sites not aligning to the query:
1druA Escherichia coli dhpr/nadh complex (see paper)
47% identity, 81% coverage: 46:242/242 of query aligns to 71:267/270 of 1druA
Sites not aligning to the query:
1arzA Escherichia coli dihydrodipicolinate reductase in complex with nadh and 2,6 pyridine dicarboxylate (see paper)
47% identity, 81% coverage: 46:242/242 of query aligns to 71:267/270 of 1arzA
Q9X1K8 4-hydroxy-tetrahydrodipicolinate reductase; HTPA reductase; EC 1.17.1.8 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
36% identity, 98% coverage: 5:240/242 of query aligns to 4:212/216 of Q9X1K8
1vm6B Crystal structure of dihydrodipicolinate reductase (tm1520) from thermotoga maritima at 2.27 a resolution
36% identity, 98% coverage: 5:240/242 of query aligns to 9:217/218 of 1vm6B
5wolA Crystal structure of dihydrodipicolinate reductase dapb from coxiella burnetii
32% identity, 90% coverage: 5:223/242 of query aligns to 8:213/230 of 5wolA
Sites not aligning to the query:
1yl5A Crystal structure of mycobacterium tuberculosis dihydrodipicolinate reductase (rv2773c) (crystal form a) (see paper)
27% identity, 100% coverage: 1:242/242 of query aligns to 2:246/247 of 1yl5A
1p9lA Structure of m. Tuberculosis dihydrodipicolinate reductase in complex with nadh and 2,6 pdc (see paper)
27% identity, 99% coverage: 4:242/242 of query aligns to 3:244/245 of 1p9lA
1c3vA Dihydrodipicolinate reductase from mycobacterium tuberculosis complexed with NADPH and pdc (see paper)
27% identity, 99% coverage: 4:242/242 of query aligns to 3:244/245 of 1c3vA
5ugvA Dapb from mycobacterium tuberculosis (see paper)
27% identity, 99% coverage: 4:242/242 of query aligns to 4:245/245 of 5ugvA
>Ga0059261_2545 FitnessBrowser__Korea:Ga0059261_2545
MSSIGIYGSLGRMGVAIRDILAEQGVKFAGGADAGDDPAVLAAAADALVDFSTPAALESH
LAAARAAGTPIVIGTTGLTAQHHALIDDAAREIAVLQTGNTSLGVVLLARLVREAATRLG
PDWDIEIAEMHHRQKVDAPSGTALMLGEAAAAGRAVSLGEVRVADRAGLTGARAEGTIGF
ASLRGGTVIGDHLVVLAGAGERIELAHRAEDRAIFARGAVRAALWLADKPAGRYTMDAVL
GL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory