Comparing Ga0059261_2552 FitnessBrowser__Korea:Ga0059261_2552 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
3u9eB The crystal structure of a possible phosphate acetyl/butaryl transferase (from listeria monocytogenes egd-e) in complex with coa.
37% identity, 88% coverage: 30:298/307 of query aligns to 26:283/288 of 3u9eB
3uf6A The crystal structure of a possible phosphate acetyl/butaryl transferase (from listeria monocytogenes egd-e) in complex with cod (3'-dephosphocoenzyme a)
37% identity, 88% coverage: 30:298/307 of query aligns to 24:281/285 of 3uf6A
1xcoD Crystal structure of a phosphotransacetylase from bacillus subtilis in complex with acetylphosphate (see paper)
26% identity, 90% coverage: 7:283/307 of query aligns to 7:306/325 of 1xcoD
Q8ZND6 Phosphate acetyltransferase; Phosphotransacetylase; EC 2.3.1.222; EC 2.3.1.8 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
31% identity, 64% coverage: 87:283/307 of query aligns to 498:691/714 of Q8ZND6
Sites not aligning to the query:
P38503 Phosphate acetyltransferase; Phosphotransacetylase; EC 2.3.1.8 from Methanosarcina thermophila (see 2 papers)
28% identity, 90% coverage: 9:283/307 of query aligns to 3:310/333 of P38503
Sites not aligning to the query:
2af3C Phosphotransacetylase from methanosarcina thermophila soaked with coenzyme a (see paper)
28% identity, 90% coverage: 9:283/307 of query aligns to 2:309/332 of 2af3C
>Ga0059261_2552 FitnessBrowser__Korea:Ga0059261_2552
MPAGERFDTLLERARGRGAIRMAIVHPTTEVVLRAAAEARDAGLIEPVLVGPERKINVAA
EEAGIDLNGWATVPTEHSHEAAERAGLLVAEGQVQALMKGALHTDELLHAVLANPKVRSA
RRLSHVFIFDDPDYHKLFMVTDGAINIAPTLAQKADIARNAIDLFVSLELGGDPPKLAAL
AAVETVSPDMVATVDAAALAKMAERGQLGRCLVDGPLAFDNAISAAAAQEKGILSAVAGD
PDILLVPNLEAGNMLAKQLTFLGDAQSAGIVVGARLPIALTSRADGARSRLMSCALAVLA
SRAGVAM
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory