SitesBLAST
Comparing Ga0059261_2605 FitnessBrowser__Korea:Ga0059261_2605 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P07913 L-threonine 3-dehydrogenase; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Escherichia coli (strain K12) (see paper)
60% identity, 100% coverage: 1:341/341 of query aligns to 1:340/341 of P07913
- C38 (= C38) mutation to D: Shows only 1% of wild-type catalytic activity. This mutant can be stimulated to the wild-type activity level after incubation with Zn(+).; mutation to S: Loss of catalytic activity. This mutant cannot be stimulated to the wild-type activity level after incubation with Zn(+).
5kiaA Crystal structure of l-threonine 3-dehydrogenase from burkholderia thailandensis
56% identity, 100% coverage: 1:341/341 of query aligns to 2:338/339 of 5kiaA
- active site: C37 (= C38), G38 (= G39), T39 (= T40), H42 (= H43), H61 (= H63), E62 (= E64), C91 (≠ D94), C94 (≠ S97), C97 (≠ A100), C105 (≠ D108), V109 (= V112), P147 (= P150), A151 (= A154), K333 (= K336)
- binding calcium ion: D146 (= D149), N150 (= N153), E288 (= E291)
- binding zinc ion: C91 (≠ D94), C94 (≠ S97), C97 (≠ A100), C105 (≠ D108)
2ejvA Crystal structure of threonine 3-dehydrogenase complexed with NAD+
45% identity, 99% coverage: 1:339/341 of query aligns to 1:339/343 of 2ejvA
- active site: C38 (= C38), G39 (= G39), T40 (= T40), H43 (= H43), H63 (= H63), E64 (= E64), C93 (≠ D94), C96 (≠ S97), C99 (≠ A100), C107 (≠ D108), Q111 (≠ V112), P149 (= P150), A153 (= A154), K336 (= K336)
- binding nicotinamide-adenine-dinucleotide: G172 (= G172), G174 (= G174), P175 (= P175), I176 (= I176), S195 (≠ T195), D196 (= D196), P197 (≠ I197), R201 (= R201), F238 (≠ M240), S239 (= S241), N241 (≠ A243), A244 (= A246), L261 (= L263), G262 (= G264), I263 (= I265)
- binding zinc ion: C38 (= C38), H63 (= H63), E64 (= E64), C96 (≠ S97), C99 (≠ A100), C107 (≠ D108)
2dq4A Crystal structure of threonine 3-dehydrogenase
45% identity, 99% coverage: 1:339/341 of query aligns to 1:339/343 of 2dq4A
- active site: C38 (= C38), G39 (= G39), T40 (= T40), H43 (= H43), H63 (= H63), E64 (= E64), C93 (≠ D94), C96 (≠ S97), C99 (≠ A100), C107 (≠ D108), Q111 (≠ V112), P149 (= P150), A153 (= A154), K336 (= K336)
- binding zinc ion: C38 (= C38), H63 (= H63), E64 (= E64), C93 (≠ D94), C96 (≠ S97), C107 (≠ D108)
Q5SKS4 L-threonine 3-dehydrogenase; TDH; EC 1.1.1.103 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
45% identity, 99% coverage: 1:339/341 of query aligns to 1:339/343 of Q5SKS4
O58389 L-threonine 3-dehydrogenase; L-ThrDH; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 2 papers)
40% identity, 99% coverage: 1:339/341 of query aligns to 5:345/348 of O58389
- C42 (= C38) binding
- T44 (= T40) mutation to A: Total loss of enzymatic activity.
- H67 (= H63) binding
- E68 (= E64) binding
- C97 (≠ D94) binding
- C100 (≠ S97) binding
- C103 (≠ A100) binding
- C111 (≠ D108) binding
- E152 (≠ D149) mutation E->A,Q: Almost complete loss of enzymatic activity.; mutation to C: 120-fold decrease in catalytic efficiency.; mutation to D: Shows 3-fold higher turnover rate and reduced affinities toward L-threonine and NAD(+), compared to wild-type.; mutation to K: Total loss of enzymatic activity.
- L179 (≠ I176) binding
- E199 (≠ D196) binding ; mutation to A: Large decrease in affinity for NAD(+).
- R204 (= R201) binding ; mutation to A: Large decrease in affinity for NAD(+).
- LGL 266:268 (≠ LGI 263:265) binding
- IT 291:292 (≠ VY 287:288) binding
- R294 (= R290) mutation to A: 4000-fold decrease in catalytic efficiency.
2dfvA Hyperthermophilic threonine dehydrogenase from pyrococcus horikoshii (see paper)
40% identity, 99% coverage: 1:339/341 of query aligns to 3:343/346 of 2dfvA
- active site: C40 (= C38), G41 (= G39), T42 (= T40), H45 (= H43), H65 (= H63), E66 (= E64), C95 (≠ D94), C98 (≠ S97), C101 (≠ A100), C109 (≠ D108), K113 (≠ V112), P151 (= P150), A155 (= A154), K340 (= K336)
- binding nicotinamide-adenine-dinucleotide: G175 (= G174), P176 (= P175), L177 (≠ I176), E197 (≠ D196), P198 (≠ I197), R202 (= R201), F241 (≠ M240), S242 (= S241), A244 (= A243), L264 (= L263), G265 (= G264), L266 (≠ I265), I289 (≠ V287), T290 (≠ Y288)
- binding zinc ion: C95 (≠ D94), C101 (≠ A100), C109 (≠ D108)
Q5JI69 L-threonine 3-dehydrogenase; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) (Pyrococcus kodakaraensis (strain KOD1)) (see paper)
39% identity, 99% coverage: 1:339/341 of query aligns to 5:345/350 of Q5JI69
3gfbA L-threonine dehydrogenase (tktdh) from the hyperthermophilic archaeon thermococcus kodakaraensis (see paper)
39% identity, 99% coverage: 1:339/341 of query aligns to 3:343/347 of 3gfbA
- active site: C40 (= C38), G41 (= G39), T42 (= T40), H45 (= H43), H65 (= H63), E66 (= E64), C95 (≠ D94), C98 (≠ S97), C101 (≠ A100), C109 (≠ D108), K113 (≠ V112), P151 (= P150), A155 (= A154), K340 (= K336)
- binding nicotinamide-adenine-dinucleotide: G173 (= G172), G175 (= G174), P176 (= P175), L177 (≠ I176), S196 (≠ T195), E197 (≠ D196), P198 (≠ I197), R202 (= R201), F241 (≠ M240), S242 (= S241), A244 (= A243), L264 (= L263), G265 (= G264), L266 (≠ I265), I289 (≠ V287), T290 (≠ Y288)
7y9pA Xylitol dehydrogenase s96c/s99c/y102c mutant(thermostabilized form) from pichia stipitis (see paper)
31% identity, 91% coverage: 25:333/341 of query aligns to 27:347/357 of 7y9pA
Q00796 Sorbitol dehydrogenase; SDH; (R,R)-butanediol dehydrogenase; L-iditol 2-dehydrogenase; Polyol dehydrogenase; Ribitol dehydrogenase; RDH; Xylitol dehydrogenase; XDH; EC 1.1.1.-; EC 1.1.1.4; EC 1.1.1.14; EC 1.1.1.56; EC 1.1.1.9 from Homo sapiens (Human) (see 10 papers)
28% identity, 95% coverage: 19:341/341 of query aligns to 26:350/357 of Q00796
- C45 (= C38) binding
- H70 (= H63) binding
- E71 (= E64) binding
- R110 (= R104) to P: in SORDD; results in protein aggregation
- H135 (≠ I128) to R: in SORDD; results in protein aggregation
- A153 (= A146) to D: in SORDD; uncertain significance; results in protein aggregation; dbSNP:rs145813597
- I184 (= I176) binding
- D204 (= D196) binding
- R209 (= R201) binding
- Q239 (≠ A227) to L: in dbSNP:rs1042079
- N269 (≠ G259) to T: in dbSNP:rs930337
- VGL 273:275 (≠ LGI 263:265) binding
- VF--R 297:299 (≠ VYGRE 287:291) binding
- V322 (≠ I313) to I: in SORDD; uncertain significance; dbSNP:rs149975952
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1pl6A Human sdh/nadh/inhibitor complex (see paper)
28% identity, 95% coverage: 19:341/341 of query aligns to 25:349/356 of 1pl6A
- active site: C44 (= C38), G45 (= G39), S46 (≠ T40), H49 (= H43), H69 (= H63), E70 (= E64), R99 (≠ D94), D102 (≠ S97), C105 (≠ A100), S113 (≠ D108), F117 (≠ V112), P156 (= P150), G160 (≠ A154), K344 (= K336)
- binding 4-[2-(hydroxymethyl)pyrimidin-4-yl]-n,n-dimethylpiperazine-1-sulfonamide: C44 (= C38), S46 (≠ T40), I56 (≠ W50), F59 (≠ R53), H69 (= H63), E155 (≠ D149), L274 (≠ I265), F297 (≠ Y288)
- binding nicotinamide-adenine-dinucleotide: G181 (= G174), P182 (= P175), I183 (= I176), D203 (= D196), L204 (≠ I197), R208 (= R201), C249 (≠ M240), T250 (≠ S241), V272 (≠ L263), G273 (= G264), L274 (≠ I265), F297 (≠ Y288), R298 (≠ E291)
- binding zinc ion: C44 (= C38), H69 (= H63)
3qe3A Sheep liver sorbitol dehydrogenase (see paper)
27% identity, 95% coverage: 19:341/341 of query aligns to 20:344/351 of 3qe3A
- active site: C39 (= C38), G40 (= G39), S41 (≠ T40), H44 (= H43), H64 (= H63), E65 (= E64), R94 (≠ D94), D97 (≠ S97), C100 (≠ A100), S108 (≠ D108), F112 (≠ V112), P151 (= P150), G155 (≠ A154), K339 (= K336)
- binding glycerol: Y45 (≠ I44), F54 (≠ R53), T116 (≠ V116), R293 (≠ E291)
- binding zinc ion: C39 (= C38), H64 (= H63), E65 (= E64)
P07846 Sorbitol dehydrogenase; SDH; L-iditol 2-dehydrogenase; Polyol dehydrogenase; Xylitol dehydrogenase; XDH; EC 1.1.1.-; EC 1.1.1.14; EC 1.1.1.9 from Ovis aries (Sheep) (see paper)
28% identity, 95% coverage: 19:341/341 of query aligns to 24:347/354 of P07846
- C43 (= C38) binding
- Y49 (≠ I44) binding
- H67 (= H63) binding
- E68 (= E64) binding
- E153 (≠ D149) binding
- R296 (≠ E291) binding
- Y297 (≠ M292) binding
P27867 Sorbitol dehydrogenase; SDH; L-iditol 2-dehydrogenase; Polyol dehydrogenase; Xylitol dehydrogenase; XDH; EC 1.1.1.-; EC 1.1.1.14; EC 1.1.1.9 from Rattus norvegicus (Rat) (see paper)
26% identity, 95% coverage: 19:341/341 of query aligns to 26:350/357 of P27867
1e3jA Ketose reductase (sorbitol dehydrogenase) from silverleaf whitefly (see paper)
29% identity, 96% coverage: 5:333/341 of query aligns to 5:333/348 of 1e3jA
- active site: C38 (= C38), G39 (= G39), S40 (≠ T40), H43 (= H43), H63 (= H63), E64 (= E64), C93 (≠ D94), C96 (≠ S97), C99 (≠ A100), C107 (≠ D108), T111 (= T111), P150 (= P150), G154 (≠ A154)
- binding phosphate ion: A174 (= A173), A196 (≠ D196), R197 (≠ I197), S198 (≠ N198), R201 (= R201)
- binding zinc ion: C38 (= C38), H63 (= H63), E64 (= E64), C93 (≠ D94), C96 (≠ S97), C99 (≠ A100), C107 (≠ D108)
Sites not aligning to the query:
5vm2A Crystal structure of eck1772, an oxidoreductase/dehydrogenase of unknown specificity involved in membrane biogenesis from escherichia coli
28% identity, 91% coverage: 18:327/341 of query aligns to 19:329/347 of 5vm2A
- active site: C39 (= C38), G40 (= G39), S41 (≠ T40), H44 (= H43), H65 (= H63), E66 (= E64), C95 (≠ D94), C98 (≠ S97), C101 (≠ A100), C109 (≠ D108), D113 (vs. gap), P153 (= P150), G157 (≠ A154)
- binding magnesium ion: H65 (= H63), E66 (= E64), E152 (≠ D149)
- binding zinc ion: C95 (≠ D94), C98 (≠ S97), C101 (≠ A100), C109 (≠ D108)
Sites not aligning to the query:
B6HI95 L-arabinitol 4-dehydrogenase; LAD; EC 1.1.1.12 from Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) (Penicillium chrysogenum) (see paper)
30% identity, 91% coverage: 27:337/341 of query aligns to 43:365/385 of B6HI95
- DI 212:213 (= DI 196:197) mutation to SR: Alters cofactor specificity from NAD to NADP; when associated with T-358.
- S358 (≠ R330) mutation to T: Alters cofactor specificity from NAD to NADP; when associated with 212-SR-213.
A2QAC0 L-arabinitol 4-dehydrogenase; LAD; EC 1.1.1.12 from Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) (see 2 papers)
30% identity, 92% coverage: 25:337/341 of query aligns to 42:366/386 of A2QAC0
- M70 (≠ R53) mutation to F: Abolishes enzyme activity.
- DI 213:214 (= DI 196:197) mutation to SR: Alters cofactor specificity from NAD to NADP; when associated with T-359.
- Y318 (≠ R290) mutation to F: Increases affinity for D-sorbitol.
- A359 (≠ R330) mutation to T: Alters cofactor specificity from NAD to NADP; when associated with 213-SR-214.
4ej6A Crystal structure of a putative zinc-binding dehydrogenase (target psi-012003) from sinorhizobium meliloti 1021
28% identity, 79% coverage: 20:288/341 of query aligns to 22:290/343 of 4ej6A
- active site: C40 (= C38), G41 (= G39), T42 (= T40), H45 (= H43), H61 (= H63), E62 (= E64), C91 (≠ D94), C94 (≠ S97), C97 (≠ A100), C105 (≠ D108), R109 (≠ V112), P147 (= P150), C151 (≠ A154)
- binding zinc ion: C91 (≠ D94), C94 (≠ S97), C97 (≠ A100), C105 (≠ D108)
Sites not aligning to the query:
Query Sequence
>Ga0059261_2605 FitnessBrowser__Korea:Ga0059261_2605
MRGLAKLHAREGIWETEAPVPTPGPDDILIRVRRTAICGTDLHIYNWDDWAARTIPVPMI
VGHEFSGEIVEIGEAVTRPLCIGQRVSGEGHIIDFDSSAARAGRFHLDPGTVGVGVNRQG
AFADYLCIPAFNVVPLPDDVSDDVGALLDPFGNAVHTAQQFDLMGEDVLVTGAGPIGIMA
AAVARRAGARSVVITDINPYRLDLAARLADVRPVNTLEEDLREVMAAEGIDDGFAVALEM
SGAPVAINQAIGALRMGGGLAMLGIPGGSMDVAWSDIILKALTIRGVYGREMFGTWQKMF
GLIRGGLDLSPLITHRLDARDFQQGFDAMRAGRAGKVVLSW
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory