Comparing Ga0059261_2606 FitnessBrowser__Korea:Ga0059261_2606 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1fc4A 2-amino-3-ketobutyrate coa ligase (see paper)
56% identity, 100% coverage: 1:400/401 of query aligns to 4:400/401 of 1fc4A
P0AB77 2-amino-3-ketobutyrate coenzyme A ligase; AKB ligase; Glycine acetyltransferase; EC 2.3.1.29 from Escherichia coli (strain K12) (see paper)
56% identity, 100% coverage: 1:400/401 of query aligns to 1:397/398 of P0AB77
3tqxA Structure of the 2-amino-3-ketobutyrate coenzyme a ligase (kbl) from coxiella burnetii (see paper)
54% identity, 97% coverage: 8:397/401 of query aligns to 7:393/396 of 3tqxA
7bxsA 2-amino-3-ketobutyrate coa ligase from cupriavidus necator glycine binding form
58% identity, 100% coverage: 2:400/401 of query aligns to 4:399/399 of 7bxsA
7bxrA 2-amino-3-ketobutyrate coa ligase from cupriavidus necator 3- hydroxynorvaline binding form
58% identity, 100% coverage: 2:400/401 of query aligns to 4:399/399 of 7bxrA
7bxqA 2-amino-3-ketobutyrate coa ligase from cupriavidus necator l-threonine binding form
58% identity, 100% coverage: 2:400/401 of query aligns to 4:399/399 of 7bxqA
7v58B Structural insights into the substrate selectivity of acyl-coa transferase (see paper)
51% identity, 100% coverage: 1:401/401 of query aligns to 3:400/400 of 7v58B
Q0P5L8 2-amino-3-ketobutyrate coenzyme A ligase, mitochondrial; AKB ligase; Aminoacetone synthase; Glycine acetyltransferase; EC 2.3.1.29 from Bos taurus (Bovine) (see paper)
50% identity, 98% coverage: 9:401/401 of query aligns to 31:419/419 of Q0P5L8
Sites not aligning to the query:
7poaA An irreversible, promiscuous and highly thermostable claisen- condensation biocatalyst drives the synthesis of substituted pyrroles
40% identity, 98% coverage: 8:400/401 of query aligns to 11:397/398 of 7poaA
8h29A Serine palmitoyltransferase from sphingobacterium multivorum complexed with l-threonine (see paper)
37% identity, 96% coverage: 13:396/401 of query aligns to 15:391/394 of 8h29A
8h21A Serine palmitoyltransferase from sphingobacterium multivorum complexed with l-alanine (see paper)
37% identity, 96% coverage: 13:396/401 of query aligns to 15:391/394 of 8h21A
8h20A Serine palmitoyltransferase from sphingobacterium multivorum complexed with glycine (see paper)
37% identity, 96% coverage: 13:396/401 of query aligns to 15:391/394 of 8h20A
8h1yA Serine palmitoyltransferase from sphingobacterium multivorum complexed with l-homoserine (see paper)
37% identity, 96% coverage: 13:396/401 of query aligns to 15:391/394 of 8h1yA
8h1qA Serine palmitoyltransferase from sphingobacterium multivorum complexed with l-serine (see paper)
37% identity, 96% coverage: 13:396/401 of query aligns to 15:391/394 of 8h1qA
8guhA Serine palmitoyltransferase from sphingobacterium multivorum complexed with tris (see paper)
37% identity, 96% coverage: 13:396/401 of query aligns to 15:391/394 of 8guhA
3a2bA Crystal structure of serine palmitoyltransferase from sphingobacterium multivorum with substrate l-serine (see paper)
37% identity, 96% coverage: 13:396/401 of query aligns to 15:391/392 of 3a2bA
P08680 5-aminolevulinate synthase, erythroid-specific, mitochondrial; ALAS-E; 5-aminolevulinic acid synthase 2; Delta-ALA synthase 2; Delta-aminolevulinate synthase 2; EC 2.3.1.37 from Mus musculus (Mouse) (see 2 papers)
34% identity, 87% coverage: 49:398/401 of query aligns to 195:548/587 of P08680
Sites not aligning to the query:
P13196 5-aminolevulinate synthase, non-specific, mitochondrial; ALAS-H; 5-aminolevulinic acid synthase 1; Delta-ALA synthase 1; Delta-aminolevulinate synthase 1; EC 2.3.1.37 from Homo sapiens (Human) (see paper)
37% identity, 81% coverage: 49:371/401 of query aligns to 249:571/640 of P13196
Sites not aligning to the query:
1djeA Crystal structure of the plp-bound form of 8-amino-7-oxonanoate synthase (see paper)
34% identity, 96% coverage: 5:390/401 of query aligns to 2:379/383 of 1djeA
1dj9A Crystal structure of 8-amino-7-oxonanoate synthase (or 7-keto- 8aminipelargonate or kapa synthase) complexed with plp and the product 8(s)-amino-7-oxonanonoate (or kapa). The enzyme of biotin biosynthetic pathway. (see paper)
34% identity, 96% coverage: 5:390/401 of query aligns to 2:379/383 of 1dj9A
>Ga0059261_2606 FitnessBrowser__Korea:Ga0059261_2606
MAGGFYDRIEAELSAIRADGLMKPERVLTTPQGAAVRIEGGPPSMLNLCANNYLGLAADP
RVVEAAIAATRNWGAGLASVRFICGTQTLHKQLEAETAAYLGYDDAILFAAAFDANGGVF
EPLLSAEDAIVSDTLNHASIIDGVRLSKAKRYRYATSDIADLERVLTTARADGARTILIA
TDGVFSMDGAIAPLDEIAALAQRFDALLLVDDCHATGIIGEGGRGSGAFRGVADKVDILT
GTYGKALGGAMGGFVAARQPVIDLLRQRARPYLFSNALAPAICGASLAAIGIAASDEGDA
LRRHLAANAALFRDRLTHAGFDLLPGEHPIIPVMLHDAAKAQRAAAELIDAGVLVAGFSF
PVVPHGKARIRTQMSAGLTADQVEQAADIFVSVGRKLDLIP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory