SitesBLAST
Comparing Ga0059261_2621 FitnessBrowser__Korea:Ga0059261_2621 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
24% identity, 91% coverage: 34:413/416 of query aligns to 29:436/446 of A0A0H2VG78
- R102 (≠ F109) mutation to A: Loss of transport activity.
- I105 (≠ V112) mutation to S: Affects symport activity. May function as an uniporter.
- E122 (= E129) mutation to A: Loss of transport activity.
- Q137 (= Q144) mutation to A: Loss of transport activity.
- Q250 (≠ N234) mutation to A: Loss of transport activity.
- Q251 (≠ L235) mutation to A: Loss of transport activity.
- N256 (= N240) mutation to A: Loss of transport activity.
- W357 (≠ F333) mutation to A: Loss of transport activity.
Sites not aligning to the query:
- 22 D→N: Affects symport activity. May function as an uniporter.
Q51955 4-hydroxybenzoate transporter PcaK from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
30% identity, 31% coverage: 7:136/416 of query aligns to 24:151/448 of Q51955
- D41 (= D24) mutation D->A,N: Abolishes 4-HBA transport.; mutation to E: Decrease in 4-HBA transport.
- D44 (≠ S27) mutation D->A,N: Abolishes 4-HBA transport.; mutation to E: Decrease in 4-HBA transport.
- G85 (= G70) mutation to V: Abolishes 4-HBA transport and chemotaxis.
- D89 (= D74) mutation to N: Abolishes 4-HBA transport and chemotaxis.
- G92 (= G77) mutation to A: Decrease in 4-HBA transport and chemotaxis.; mutation to C: No change in 4-HBA transport and chemotaxis.; mutation G->L,V: Abolishes 4-HBA transport and chemotaxis.; mutation to Q: Decrease in 4-HBA transport and strong decrease in chemotaxis.
- R124 (≠ F109) mutation to A: Abolishes 4-HBA transport.
- E144 (= E129) mutation to A: Strong decrease in 4-HBA transport.
Sites not aligning to the query:
- 183 H→A: Decrease in 4-HBA transport and chemotaxis.
- 323 D→N: Abolishes 4-HBA transport and chemotaxis.
- 328 H→A: Decrease in 4-HBA transport and chemotaxis.; H→R: Decrease in 4-HBA transport and loss of chemotaxis.
- 386 R→A: Strong decrease in 4-HBA transport.
- 398 R→A: Abolishes 4-HBA transport.
- 444 H→A: No change in 4-HBA transport and chemotaxis.
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
26% identity, 80% coverage: 28:360/416 of query aligns to 59:387/444 of Q8NLB7
- R103 (≠ L75) mutation to A: Loss of transport activity.
- W309 (≠ K280) mutation to V: Loss of transport activity.
- D312 (= D283) mutation to A: Loss of transport activity.
- R313 (= R284) mutation to A: Loss of transport activity.
- I317 (≠ R288) mutation I->H,Y: Loss of transport activity.
- R386 (= R359) mutation to A: Loss of transport activity.
Sites not aligning to the query:
- 54 D→A: Loss of transport activity.; D→E: Retains 50% of its transport activity.
- 57 D→A: Loss of transport activity.; D→E: Retains 50% of its transport activity.
Query Sequence
>Ga0059261_2621 FitnessBrowser__Korea:Ga0059261_2621
MSSASADREDWKNTILAGLANYIDAGSIVAGAVALALWKKEYGLDDSLLGLIAAFGPNAI
AAGIGALIGGRLCDLLGRKKIYQYDMLFYAFGMLWLVFAMNAWMVIIGFFLVGLAVGADI
PASWSLIAEMAPDKKRGKHSGVAQLLWYLGPVVVLVMALVLDKLGLLGVRIIFAHLAILA
IALTFLRSKMQESQRWVEAQKSGETAQRGRWQDLFTRQHIGSMAFLAGTYLFWNLWAGTN
GFFFPYILSTVGSQTQVVSVAVQTLSFLLGMASIFFIFMKLADRVNQRLLFGISAVTQVI
GMALLAIFPLTLPVAIIHVFLMSVGGGFGAQSFFQLWSSEMFPTALRATAQGVMFAIVRI
VLGVFSFFVPALVATGFHTLAWILVGFLAISGVIGFVWAPRNEGKSLEQLDAERAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory