SitesBLAST
Comparing Ga0059261_2623 FitnessBrowser__Korea:Ga0059261_2623 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P18157 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Bacillus subtilis (strain 168) (see paper)
40% identity, 97% coverage: 6:487/496 of query aligns to 5:493/496 of P18157
- H230 (≠ T230) mutation to R: Increased activity.
- F232 (≠ L232) mutation to S: Increased activity.
P0A6F3 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Escherichia coli (strain K12) (see 10 papers)
39% identity, 97% coverage: 6:487/496 of query aligns to 7:495/502 of P0A6F3
- T14 (= T13) binding ADP; binding sn-glycerol 3-phosphate
- R18 (≠ K17) binding ADP
- S59 (≠ A58) mutation to W: Abolishes inhibition of GK by FBP via disruption of the dimer-tetramer assembly reaction. Inhibition by EIIA-Glc is unchanged compared to wild type. The activity of this mutant is significantly higher than wild-type, and the Michaelis constants are increased slightly compared to wild-type.
- A66 (= A65) mutation to T: Although it completely abolishes FBP regulation and disrupts dimer-tetramer equilibrium, the crystal structure is essentially identical to the symmetric tetramer found in the FBP-bound form of the enzyme.
- R84 (= R81) binding glycerol; binding sn-glycerol 3-phosphate
- E85 (= E82) binding glycerol; binding sn-glycerol 3-phosphate
- Y136 (≠ L133) binding glycerol; binding sn-glycerol 3-phosphate
- G231 (= G228) mutation to D: Displays an increased enzymatic activity and a decreased allosteric regulation by FBP compared to wild-type. It displays a dimer form and is resistant to tetramer formation in the presence of FBP, whereas wild-type dimers are converted into inactive tetramers in the presence of FBP.
- K233 (≠ P233) modified: N6-malonyllysine
- G235 (= G235) binding beta-D-fructose 1,6-bisphosphate
- R237 (vs. gap) binding beta-D-fructose 1,6-bisphosphate; mutation to A: Drastically reduces inhibition of GK by FBP and lowers, but did not eliminate, the ability of FBP to promote tetramer association.
- D246 (= D244) binding glycerol; binding sn-glycerol 3-phosphate
- Q247 (≠ S245) binding glycerol
- T268 (= T266) binding ADP
- G305 (= G303) mutation to S: In glpK22; abolishes glucose control of glycerol utilization.
- G311 (= G309) binding ADP
- G412 (= G409) binding ADP
- N416 (= N413) binding ADP
- I475 (≠ L467) mutation to D: It decreases Vmax to about 10% of the wild-type value and the affinity for substrate is increased about two- to fourfold. This mutation decreases the catalytic activity in a manner that is analogous to that obtained upon EIIA-Glc binding. It increases the affinity for FBP about fivefold.
- E479 (≠ A471) binding Zn(2+)
- R480 (= R472) mutation to D: It decreases Vmax to about 10% of the wild-type value and the affinity for substrate is increased about two- to fourfold. This mutation decreases the catalytic activity in a manner that is analogous to that obtained upon EIIA-Glc binding. Regulation by FBP is not affected by this substitution. No inhibition by EIIA-Glc is observed, which is consistent with a decrease in affinity for EIIA-Glc of about 250-fold.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1gllO Escherichia coli glycerol kinase mutant with bound atp analog showing substantial domain motion (see paper)
39% identity, 97% coverage: 6:487/496 of query aligns to 5:489/494 of 1gllO
- binding phosphomethylphosphonic acid adenylate ester: T12 (= T13), T13 (= T14), G261 (= G265), T262 (= T266), G305 (= G309), I308 (≠ A312), Q309 (≠ A313), A321 (≠ Q325), G406 (= G409), N410 (= N413)
- binding glycerol: R82 (= R81), E83 (= E82), Y134 (≠ L133), D240 (= D244), Q241 (≠ S245), F265 (≠ S269)
1gljO Escherichia coli glycerol kinase mutant with bound atp analog showing substantial domain motion (see paper)
39% identity, 97% coverage: 6:487/496 of query aligns to 5:489/494 of 1gljO
- binding gamma-arsono-beta, gamma-methyleneadenosine-5'-diphosphate: T12 (= T13), T13 (= T14), G261 (= G265), T262 (= T266), G305 (= G309), Q309 (≠ A313), A321 (≠ Q325), G406 (= G409), A407 (= A410)
- binding glycerol: R82 (= R81), E83 (= E82), W102 (= W101), Y134 (≠ L133), D240 (= D244), F265 (≠ S269)
1bwfO Escherichia coli glycerol kinase mutant with bound atp analog showing substantial domain motion (see paper)
39% identity, 97% coverage: 6:487/496 of query aligns to 5:489/494 of 1bwfO
- binding phosphodifluoromethylphosphonic acid-adenylate ester: T12 (= T13), T13 (= T14), T262 (= T266), G305 (= G309), I308 (≠ A312), Q309 (≠ A313), A321 (≠ Q325), G406 (= G409), N410 (= N413)
- binding glycerol: R82 (= R81), E83 (= E82), W102 (= W101), Y134 (≠ L133), D240 (= D244), Q241 (≠ S245), F265 (≠ S269)
1glfO Crystal structures of escherichia coli glycerol kinase and the mutant a65t in an inactive tetramer: conformational changes and implications for allosteric regulation (see paper)
39% identity, 97% coverage: 6:487/496 of query aligns to 5:493/498 of 1glfO
- binding adenosine-5'-diphosphate: R16 (≠ K17), G265 (= G265), T266 (= T266), G309 (= G309), G410 (= G409), A411 (= A410)
- binding glycerol: R82 (= R81), E83 (= E82), Y134 (≠ L133), D244 (= D244)
- binding phosphate ion: G232 (≠ A234), G233 (= G235), R235 (vs. gap)
1bo5O Crystal structure of the complex between escherichia coli glycerol kinase and the allosteric regulator fructose 1,6-bisphosphate. (see paper)
39% identity, 97% coverage: 6:487/496 of query aligns to 5:493/498 of 1bo5O
1bu6Y Crystal structures of escherichia coli glycerol kinase and the mutant a65t in an inactive tetramer: conformational changes and implications for allosteric regulation (see paper)
39% identity, 97% coverage: 6:487/496 of query aligns to 5:493/499 of 1bu6Y
1gldG Cation promoted association (cpa) of a regulatory and target protein is controlled by phosphorylation (see paper)
39% identity, 97% coverage: 6:487/496 of query aligns to 3:484/489 of 1gldG
- binding adenosine-5'-diphosphate: R14 (≠ K17), G256 (= G265), T257 (= T266), G300 (= G309), A316 (≠ Q325), G401 (= G409), A402 (= A410), N405 (= N413)
- binding glyceraldehyde-3-phosphate: T10 (= T13), R80 (= R81), E81 (= E82), Y132 (≠ L133), D235 (= D244), F260 (≠ S269)
- binding manganese (ii) ion: D7 (= D10), R14 (≠ K17)
1glcG Cation promoted association (cpa) of a regulatory and target protein is controlled by phosphorylation (see paper)
39% identity, 97% coverage: 6:487/496 of query aligns to 3:484/489 of 1glcG
- binding adenosine-5'-diphosphate: G256 (= G265), T257 (= T266), G300 (= G309), A316 (≠ Q325), G401 (= G409), A402 (= A410), N405 (= N413)
- binding glyceraldehyde-3-phosphate: T10 (= T13), R80 (= R81), E81 (= E82), W100 (= W101), Y132 (≠ L133), D235 (= D244), F260 (≠ S269)
1glbG Structure of the regulatory complex of escherichia coli iiiglc with glycerol kinase (see paper)
39% identity, 97% coverage: 6:487/496 of query aligns to 3:484/489 of 1glbG
- binding adenosine-5'-diphosphate: R14 (≠ K17), G256 (= G265), T257 (= T266), G300 (= G309), I303 (≠ A312), A316 (≠ Q325), G401 (= G409), A402 (= A410), N405 (= N413)
- binding glycerol: R80 (= R81), E81 (= E82), W100 (= W101), Y132 (≠ L133), D235 (= D244), F260 (≠ S269)
6udeB Crystal structure of glycerol kinase from elizabethkingia anophelis nuhp1 in complex with adp and glycerol
42% identity, 91% coverage: 6:454/496 of query aligns to 5:452/495 of 6udeB
- binding adenosine-5'-diphosphate: R16 (≠ K17), G262 (= G265), T263 (= T266), G306 (= G309), I309 (≠ A312), S323 (≠ Q325), G406 (= G408), G407 (= G409), A408 (= A410)
- binding magnesium ion: G11 (= G12), T12 (= T13), T13 (= T14), S14 (≠ N15)
Q5HGD2 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Staphylococcus aureus (strain COL)
38% identity, 96% coverage: 6:483/496 of query aligns to 5:489/498 of Q5HGD2
- T12 (= T13) binding ADP
- R16 (≠ K17) binding ADP
- R82 (= R81) binding glycerol
- E83 (= E82) binding glycerol
- Y134 (≠ L133) binding glycerol
- D244 (= D244) binding glycerol
- Q245 (≠ S245) binding glycerol
- T266 (= T266) binding ADP
- G309 (= G309) binding ADP
- Q313 (≠ A313) binding ADP
- G410 (= G409) binding ADP
- N414 (= N413) binding ADP
3ge1A 2.7 angstrom crystal structure of glycerol kinase (glpk) from staphylococcus aureus in complex with adp and glycerol
38% identity, 96% coverage: 6:483/496 of query aligns to 6:490/499 of 3ge1A
6k76A Glycerol kinase form thermococcus kodakarensis, complex structure with substrate.
40% identity, 97% coverage: 6:487/496 of query aligns to 1:478/485 of 6k76A
O34154 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Enterococcus faecalis (strain ATCC 700802 / V583) (see 2 papers)
36% identity, 98% coverage: 6:492/496 of query aligns to 7:501/501 of O34154
- H231 (≠ T230) modified: Phosphohistidine; by HPr
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
3h3nX Glycerol kinase h232r with glycerol (see paper)
37% identity, 97% coverage: 6:484/496 of query aligns to 6:491/501 of 3h3nX
O34153 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Enterococcus casseliflavus (Enterococcus flavescens) (see 3 papers)
37% identity, 97% coverage: 6:484/496 of query aligns to 7:492/506 of O34153
- R84 (= R81) binding glycerol
- E85 (= E82) binding glycerol
- Y136 (≠ L133) binding glycerol
- H232 (≠ T230) modified: Phosphohistidine; by HPr; mutation to A: Loss of phosphorylation, no effect on activity.; mutation to E: Loss of phosphorylation, 2.5-fold reduced activity.; mutation to R: Loss of phosphorylation, 3.4-fold increased activity.
- D246 (= D244) binding glycerol
- Q247 (≠ S245) binding glycerol
O86033 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)
38% identity, 98% coverage: 3:490/496 of query aligns to 2:497/497 of O86033
- R82 (= R81) binding glycerol
- E83 (= E82) binding glycerol
- Y134 (≠ L133) binding glycerol
- D243 (= D244) binding glycerol
- Q244 (≠ S245) binding glycerol
2w41B Crystal structure of plasmodium falciparum glycerol kinase with adp (see paper)
32% identity, 91% coverage: 2:454/496 of query aligns to 6:465/507 of 2w41B
Query Sequence
>Ga0059261_2623 FitnessBrowser__Korea:Ga0059261_2623
MSGPAILAIDQGTTNTKALLVAADGSVVISRSRSMQVTYPQPGWAEQSASDIWEAVAALI
AELVAAAPDAQIAALAISNQRETVVLWEADTGRPVAPAVIWQCARSAERCADLRAAGLED
AIVARSGLGIDPLFPAAKIGWLLDTIPGARDRANAGEIKCGTIDSWLLWNLTGGKVHATD
HSNASRTQLFNLDTLDWDAELARIFDVPLAILPRIAPSDGGFGTVAPGLTALPAGTPVQV
LLGDSHAALFAHGILAPGRVKATIGTGSSLMAATAGRVRSSHGLSSTIAWSRTGTGAQHA
IEGNISVSGHAAAFATALLGLADEQALTDLAASVESSEGVVFVPALAGLGAPHWQTGARG
TISGMTLATRPAHVARATLEAIALQIGDVLDAIAADLGIDLPELSIDGGAARNALLAQLL
ADLTGRTIVRPEIAEASALGVARMAADALGLADSGAMAAADRFEPKLAEDAREAIRGNWR
ESIADAVMRANRAPPG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory