SitesBLAST
Comparing Ga0059261_2629 FitnessBrowser__Korea:Ga0059261_2629 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6gmcA 1.2 a resolution structure of human hydroxyacid oxidase 1 bound with fmn and 4-carboxy-5-[(4-chlorophenyl)sulfanyl]-1,2,3-thiadiazole
36% identity, 97% coverage: 7:374/379 of query aligns to 9:358/360 of 6gmcA
- active site: Y132 (= Y128), D160 (= D156), H258 (= H274)
- binding 5-[(4-chlorophenyl)sulfanyl]-1,2,3-thiadiazole-4-carboxylate: Y26 (= Y24), M82 (≠ I80), W110 (≠ V108), Y132 (= Y128), R167 (= R163), F191 (≠ G186), L203 (= L216), Y206 (= Y219), H258 (= H274), R261 (= R277)
- binding flavin mononucleotide: Y26 (= Y24), Y27 (≠ A25), A79 (≠ P77), T80 (≠ V78), A81 (≠ G79), S108 (= S106), Q130 (= Q126), Y132 (= Y128), T158 (= T154), K234 (= K250), H258 (= H274), G259 (= G275), R261 (= R277), D289 (= D305), G290 (= G306), R293 (= R309), G312 (= G328), R313 (= R329)
5zzqA The crystal structure of mandelate oxidase with (s)-4-hydroxymandelic acid (see paper)
41% identity, 97% coverage: 5:371/379 of query aligns to 3:347/355 of 5zzqA
- active site: Y126 (= Y128), D154 (= D156), H250 (= H274)
- binding flavin mononucleotide: P75 (= P77), V76 (= V78), A77 (≠ G79), Q124 (= Q126), Y126 (= Y128), T152 (= T154), K226 (= K250), H250 (= H274), R253 (= R277), D281 (= D305), G283 (= G307), R285 (= R309), G304 (= G328), R305 (= R329)
- binding (2S)-hydroxy(4-hydroxyphenyl)ethanoic acid: L106 (≠ V108), Y126 (= Y128), M158 (≠ P160), R161 (= R163), T200 (≠ M220), F204 (= F227), H250 (= H274), R253 (= R277)
6a24A The crystal structure of mandelate oxidase with 3-fluoropyruvate (see paper)
41% identity, 97% coverage: 5:371/379 of query aligns to 3:347/354 of 6a24A
- active site: Y126 (= Y128), D154 (= D156), H250 (= H274)
- binding flavin mononucleotide: P75 (= P77), V76 (= V78), A77 (≠ G79), Q124 (= Q126), Y126 (= Y128), T152 (= T154), K226 (= K250), H250 (= H274), G251 (= G275), R253 (= R277), D281 (= D305), G282 (= G306), G283 (= G307), R285 (= R309), G304 (= G328), R305 (= R329)
- binding pyruvic acid: R161 (= R163), H250 (= H274), R253 (= R277)
6gmbA Structure of human hydroxyacid oxidase 1 bound with fmn and glycolate
37% identity, 97% coverage: 7:374/379 of query aligns to 9:360/362 of 6gmbA
- active site: Y132 (= Y128), D160 (= D156), H260 (= H274)
- binding flavin mononucleotide: Y26 (= Y24), Y27 (≠ A25), A79 (≠ P77), T80 (≠ V78), A81 (≠ G79), S108 (= S106), Q130 (= Q126), Y132 (= Y128), K236 (= K250), H260 (= H274), G261 (= G275), R263 (= R277), D291 (= D305), G292 (= G306), G293 (= G307), R295 (= R309), G314 (= G328), R315 (= R329)
- binding glycolic acid: Y26 (= Y24), W110 (≠ V108), Y132 (= Y128), R167 (= R163), H260 (= H274), R263 (= R277)
Q9UJM8 2-Hydroxyacid oxidase 1; HAOX1; Glycolate oxidase; GO; GOX; Glyoxylate oxidase; EC 1.1.3.15; EC 1.2.3.5 from Homo sapiens (Human) (see 2 papers)
37% identity, 97% coverage: 7:374/379 of query aligns to 9:360/370 of Q9UJM8
7r4nA Structure of human hydroxyacid oxidase 1 bound with 5-bromo-n-methyl- 1h-indazole-3-carboxamide
36% identity, 97% coverage: 7:374/379 of query aligns to 8:350/352 of 7r4nA
- binding 5-bromanyl-N-methyl-1H-indazole-3-carboxamide: Y25 (= Y24), A80 (≠ G79), M81 (≠ I80), W109 (≠ V108), Y131 (= Y128), R166 (= R163), M182 (≠ L203), H250 (= H274), R253 (= R277)
- binding flavin mononucleotide: Y25 (= Y24), Y26 (≠ A25), A78 (≠ P77), T79 (≠ V78), A80 (≠ G79), S107 (= S106), W109 (≠ V108), Q129 (= Q126), Y131 (= Y128), T157 (= T154), K226 (= K250), H250 (= H274), G251 (= G275), R253 (= R277), D281 (= D305), G282 (= G306), R285 (= R309), G304 (= G328), R305 (= R329)
5qigA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with z1407672867
37% identity, 97% coverage: 7:374/379 of query aligns to 6:357/359 of 5qigA
- active site: Y129 (= Y128), D157 (= D156), H257 (= H274)
- binding flavin mononucleotide: Y23 (= Y24), Y24 (≠ A25), A76 (≠ P77), T77 (≠ V78), A78 (≠ G79), S105 (= S106), Q127 (= Q126), Y129 (= Y128), T155 (= T154), K233 (= K250), H257 (= H274), G258 (= G275), R260 (= R277), D288 (= D305), G289 (= G306), G290 (= G307), R292 (= R309), G311 (= G328), R312 (= R329)
- binding 2-cyclopropyl-1~{H}-imidazole-4-carboxamide: R223 (= R240), G248 (= G265), F320 (≠ A337), K324 (≠ A341), D328 (≠ K345)
Sites not aligning to the query:
5qifA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with z31792168
37% identity, 97% coverage: 7:374/379 of query aligns to 6:357/359 of 5qifA
- active site: Y129 (= Y128), D157 (= D156), H257 (= H274)
- binding flavin mononucleotide: Y23 (= Y24), Y24 (≠ A25), A76 (≠ P77), T77 (≠ V78), A78 (≠ G79), S105 (= S106), Q127 (= Q126), Y129 (= Y128), K233 (= K250), H257 (= H274), G258 (= G275), R260 (= R277), D288 (= D305), G289 (= G306), R292 (= R309), G311 (= G328), R312 (= R329)
- binding 2-cyclohexyl-~{N}-pyridin-3-yl-ethanamide: R223 (= R240), R224 (≠ A241), S227 (≠ D244)
2rdwA Crystal structure of human glycolate oxidase in complex with sulfate (see paper)
37% identity, 97% coverage: 7:374/379 of query aligns to 6:357/359 of 2rdwA
- active site: S105 (= S106), Y129 (= Y128), T155 (= T154), D157 (= D156), K233 (= K250), H257 (= H274)
- binding flavin mononucleotide: Y23 (= Y24), Y24 (≠ A25), A76 (≠ P77), T77 (≠ V78), A78 (≠ G79), Q127 (= Q126), Y129 (= Y128), T155 (= T154), K233 (= K250), H257 (= H274), G258 (= G275), R260 (= R277), D288 (= D305), G289 (= G306), R292 (= R309), G311 (= G328), R312 (= R329)
- binding sulfate ion: Y23 (= Y24), W107 (≠ V108), R164 (= R163), H257 (= H274), R260 (= R277)
2rduA Crystal structure of human glycolate oxidase in complex with glyoxylate (see paper)
37% identity, 97% coverage: 7:374/379 of query aligns to 7:358/360 of 2rduA
- active site: S106 (= S106), Y130 (= Y128), T156 (= T154), D158 (= D156), K234 (= K250), H258 (= H274)
- binding flavin mononucleotide: Y24 (= Y24), Y25 (≠ A25), A77 (≠ P77), T78 (≠ V78), A79 (≠ G79), S106 (= S106), Q128 (= Q126), Y130 (= Y128), T156 (= T154), K234 (= K250), H258 (= H274), G259 (= G275), R261 (= R277), D289 (= D305), G290 (= G306), G291 (= G307), R293 (= R309), G312 (= G328), R313 (= R329)
- binding glyoxylic acid: Y24 (= Y24), W108 (≠ V108), Y130 (= Y128), R165 (= R163), H258 (= H274), R261 (= R277)
5qieA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with z2856434894
37% identity, 97% coverage: 7:374/379 of query aligns to 6:351/353 of 5qieA
- active site: Y129 (= Y128), D157 (= D156), H251 (= H274)
- binding flavin mononucleotide: Y23 (= Y24), Y24 (≠ A25), A76 (≠ P77), T77 (≠ V78), A78 (≠ G79), S105 (= S106), Q127 (= Q126), Y129 (= Y128), K227 (= K250), H251 (= H274), G252 (= G275), R254 (= R277), D282 (= D305), G283 (= G306), R286 (= R309), G305 (= G328), R306 (= R329)
- binding ~{N},~{N}-dimethyl-4-[(propan-2-ylamino)methyl]aniline: D322 (≠ K345)
Sites not aligning to the query:
Q8Z0C8 L-lactate oxidase; LOX; Glyoxylate oxidase; No-LOX; EC 1.1.3.-; EC 1.2.3.5 from Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) (see paper)
39% identity, 97% coverage: 8:374/379 of query aligns to 12:363/365 of Q8Z0C8
- M82 (≠ V78) mutation to T: Increases oxidation activity with both L-lactate and glycolate. Shows a 6-fold decrease in the L-lactate/glycolate oxidase activity ratio.
- L112 (≠ V108) mutation to W: Impairs oxidation of L-lactate. Shows a 2-fold decrease in the L-lactate/glycolate oxidase activity ratio.
- F212 (≠ L223) mutation to V: Impairs oxidation of L-lactate. Shows a 27-fold decrease in the L-lactate/glycolate oxidase activity ratio.
5qihA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with z2697514548
36% identity, 97% coverage: 7:374/379 of query aligns to 6:342/344 of 5qihA
- active site: Y129 (= Y128), D157 (= D156), H242 (= H274)
- binding flavin mononucleotide: Y23 (= Y24), Y24 (≠ A25), A76 (≠ P77), T77 (≠ V78), A78 (≠ G79), S105 (= S106), Q127 (= Q126), Y129 (= Y128), K218 (= K250), H242 (= H274), G243 (= G275), R245 (= R277), D273 (= D305), G274 (= G306), R277 (= R309), G296 (= G328), R297 (= R329)
- binding 1-methylindazole-3-carboxamide: Y23 (= Y24), A78 (≠ G79), M79 (≠ I80), W107 (≠ V108), Y129 (= Y128), M180 (≠ L178), L187 (= L216), H242 (= H274)
5qidA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with z1787627869
36% identity, 97% coverage: 7:374/379 of query aligns to 6:342/344 of 5qidA
- active site: Y129 (= Y128), D157 (= D156), H242 (= H274)
- binding flavin mononucleotide: Y23 (= Y24), Y24 (≠ A25), A76 (≠ P77), T77 (≠ V78), A78 (≠ G79), S105 (= S106), Q127 (= Q126), Y129 (= Y128), K218 (= K250), H242 (= H274), G243 (= G275), R245 (= R277), D273 (= D305), G274 (= G306), R277 (= R309), G296 (= G328), R297 (= R329)
- binding 5-chloranyl-~{N}-methyl-~{N}-[[(3~{S})-oxolan-3-yl]methyl]pyrimidin-4-amine: T57 (≠ V58), E320 (≠ R352), R323 (≠ K355)
5qicA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with z30620520
36% identity, 97% coverage: 7:374/379 of query aligns to 6:342/344 of 5qicA
- active site: Y129 (= Y128), D157 (= D156), H242 (= H274)
- binding flavin mononucleotide: Y23 (= Y24), Y24 (≠ A25), A76 (≠ P77), T77 (≠ V78), A78 (≠ G79), S105 (= S106), Q127 (= Q126), Y129 (= Y128), K218 (= K250), H242 (= H274), G243 (= G275), R245 (= R277), D273 (= D305), G274 (= G306), R277 (= R309), G296 (= G328), R297 (= R329)
- binding cyclopropyl-[4-(4-fluorophenyl)piperazin-1-yl]methanone: Y131 (≠ I130), K132 (≠ R131), V136 (≠ F135), M180 (≠ L178), F183 (≠ I181), Y190 (= Y219), K193 (= K225), A194 (≠ N226)
5qibA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with fmopl000388a
36% identity, 97% coverage: 7:374/379 of query aligns to 6:342/344 of 5qibA
- active site: Y129 (= Y128), D157 (= D156), H242 (= H274)
- binding 1-deoxy-1-(7,8-dimethyl-2,4-dioxo-3,4-dihydro-2h-benzo[g]pteridin-1-id-10(5h)-yl)-5-o-phosphonato-d-ribitol: Y23 (= Y24), Y24 (≠ A25), A76 (≠ P77), T77 (≠ V78), A78 (≠ G79), S105 (= S106), Q127 (= Q126), Y129 (= Y128), K218 (= K250), H242 (= H274), G243 (= G275), R245 (= R277), D273 (= D305), G274 (= G306), G275 (= G307), R277 (= R309), G296 (= G328), R297 (= R329)
- binding 5-(cyclohexylamino)pyrimidine-2,4(1H,3H)-dione: Y23 (= Y24), M79 (≠ I80), W107 (≠ V108), Y129 (= Y128), R164 (= R163), M180 (≠ L178), L187 (= L216), H242 (= H274), R245 (= R277)
5zztA The crystal structure of mandelate oxidase with 3,3-difluoro-2- hydroxy-3-phenylpropionic acid (see paper)
40% identity, 97% coverage: 5:371/379 of query aligns to 3:324/331 of 5zztA
- active site: Y126 (= Y128), D154 (= D156), H227 (= H274)
- binding (2R)-3,3-difluoro-2-hydroxy-3-phenylpropanoic acid: F22 (≠ Y24), Y126 (= Y128), M158 (≠ P160), R161 (= R163), H227 (= H274), R230 (= R277)
- binding flavin mononucleotide: P75 (= P77), V76 (= V78), A77 (≠ G79), Q124 (= Q126), Y126 (= Y128), T152 (= T154), K203 (= K250), H227 (= H274), G228 (= G275), R230 (= R277), D258 (= D305), G259 (= G306), G260 (= G307), R262 (= R309), G281 (= G328), R282 (= R329)
P05414 Glycolate oxidase; GAO; GOX; Short chain alpha-hydroxy acid oxidase; EC 1.1.3.15 from Spinacia oleracea (Spinach) (see 4 papers)
37% identity, 99% coverage: 1:375/379 of query aligns to 1:355/369 of P05414
- M1 (= M1) modified: N-acetylmethionine
- Y24 (= Y24) mutation to F: 10-fold decrease in affinity for glycolate.
- PTA 77:79 (≠ PVG 77:79) binding
- S106 (= S106) binding
- W108 (≠ V108) mutation to S: 100-fold decrease in affinity for glycolate and 500-fold decrease in activity.
- QLY 127:129 (= QLY 126:128) binding
- T155 (= T154) binding
- K230 (= K250) binding
- S252 (= S272) binding
- DGGVR 285:289 (≠ DGGIR 305:309) binding
- GR 308:309 (= GR 328:329) binding
7r4oA Structure of human hydroxyacid oxidase 1 bound with 2-((4h-1,2,4- triazol-3-yl)thio)-1-(4-(3-chlorophenyl)piperazin-1-yl)ethan-1-one
36% identity, 97% coverage: 7:374/379 of query aligns to 7:339/341 of 7r4oA
- binding flavin mononucleotide: Y25 (≠ A25), A77 (≠ P77), T78 (≠ V78), A79 (≠ G79), S106 (= S106), Q128 (= Q126), Y130 (= Y128), K215 (= K250), H239 (= H274), G240 (= G275), R242 (= R277), D270 (= D305), G271 (= G306), R274 (= R309), G293 (= G328), R294 (= R329)
- binding 2-((4H-1,2,4-triazol-3-yl)thio)-1-(4-(3-chlorophenyl)piperazin-1-yl)ethan-1-one: Y132 (≠ I130), K133 (≠ R131), D134 (= D132), N183 (= N205), K190 (= K225)
6a1hA Mandelate oxidase mutant-y128f with 5-deazariboflavin mononucleotide (see paper)
40% identity, 97% coverage: 5:371/379 of query aligns to 3:324/332 of 6a1hA
- active site: F126 (≠ Y128), D154 (= D156), H227 (= H274)
- binding 1-deoxy-1-(7,8-dimethyl-2,4-dioxo-3,4-dihydropyrimido[4,5-b]quinolin-10(2H)-yl)-5-O-phosphono-D-ribitol: A74 (≠ G76), P75 (= P77), V76 (= V78), A77 (≠ G79), Q124 (= Q126), F126 (≠ Y128), T152 (= T154), K203 (= K250), H227 (= H274), R230 (= R277), D258 (= D305), G260 (= G307), R262 (= R309), G281 (= G328), R282 (= R329)
Query Sequence
>Ga0059261_2629 FitnessBrowser__Korea:Ga0059261_2629
MIIASSHDFEKAARRRVPRFLFDYAEGGAYDEVTLGRNVSDLAAIALRQRVLKDVANVDL
KTTLFGREVALPVALGPVGISGMYARRGEVQAARAAKAAGIPTCLSTVSICALEEVAAAA
DPFWFQLYVIRDRGFMRDLIARAKAAGAEAMVFTVDMPIPGARYRSEHSGMAGPNARLRQ
ILQAIGKPHWAWDVGLMGRPHTLGNLAPVLGKDSGLSDYMGWLGKNFDPSIQWKDLDWIR
AEWDRPLIIKGILDPEDAREAAAIGANGIVVSNHGGRQLDGVLSSARALPPIADAVGGQL
TVLADGGIRTGLDVVRMLALGADGVLLGRAWVYALAAQGEAGVTKLLALIAREMKVAMTL
TGVNRIGAIDRSILAEGVK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory