SitesBLAST
Comparing Ga0059261_2631 FitnessBrowser__Korea:Ga0059261_2631 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7qh2C Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
30% identity, 92% coverage: 12:465/493 of query aligns to 7:463/467 of 7qh2C
- binding flavin-adenine dinucleotide: V73 (≠ P78), G75 (= G80), S76 (≠ A81), G77 (= G82), T78 (= T83), G79 (≠ S84), L80 (= L85), A83 (≠ G88), C84 (≠ A89), P137 (= P142), G138 (≠ S143), E139 (≠ S144), A142 (= A147), T143 (= T149), G146 (= G152), N147 (= N153), S149 (≠ A155), T150 (≠ E156), A152 (≠ S158), G153 (= G159), E203 (= E208), G204 (= G209), I209 (≠ V214), E422 (= E424), H423 (= H425)
- binding fe (iii) ion: H377 (= H380), H384 (= H387), E422 (= E424)
P9WIT1 Uncharacterized FAD-linked oxidoreductase Rv2280; EC 1.-.-.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
35% identity, 86% coverage: 43:466/493 of query aligns to 33:456/459 of P9WIT1
- K354 (≠ E359) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
8jdvA Crystal structure of mldhd in complex with 2-ketohexanoic acid (see paper)
31% identity, 92% coverage: 14:466/493 of query aligns to 4:454/454 of 8jdvA
- binding 2-Ketohexanoic acid: V75 (≠ L85), R317 (= R331), W321 (≠ F335), H368 (= H380), H375 (= H387), H413 (= H425)
- binding flavin-adenine dinucleotide: P68 (= P78), G70 (= G80), T71 (≠ A81), G72 (= G82), T73 (= T83), G74 (≠ S84), G78 (= G88), V79 (≠ A89), L90 (≠ M100), P132 (= P142), G133 (≠ S143), A134 (≠ S144), G140 (= G152), M141 (≠ N153), A143 (= A155), T144 (≠ E156), A146 (≠ S158), S147 (≠ G159), E200 (= E208), G201 (= G209), I206 (≠ V214), W321 (≠ F335), Y322 (≠ P336), E412 (= E424), H413 (= H425), N449 (= N461)
- binding manganese (ii) ion: H368 (= H380), H375 (= H387), E412 (= E424)
8jdeA Crystal structure of mldhd in complex with d-lactate (see paper)
31% identity, 92% coverage: 14:466/493 of query aligns to 4:455/455 of 8jdeA
- binding flavin-adenine dinucleotide: P68 (= P78), G70 (= G80), T71 (≠ A81), G72 (= G82), T73 (= T83), G74 (≠ S84), G78 (= G88), V79 (≠ A89), L90 (≠ M100), P132 (= P142), G133 (≠ S143), A134 (≠ S144), G140 (= G152), M141 (≠ N153), A143 (= A155), T144 (≠ E156), A146 (≠ S158), S147 (≠ G159), E200 (= E208), G201 (= G209), I206 (≠ V214), W322 (≠ F335), E413 (= E424), H414 (= H425), N450 (= N461)
- binding lactic acid: R318 (= R331), H369 (= H380), H376 (= H387), H414 (= H425)
- binding manganese (ii) ion: H369 (= H380), H376 (= H387), E413 (= E424)
8jdsA Crystal structure of mldhd in complex with pyruvate (see paper)
30% identity, 92% coverage: 14:466/493 of query aligns to 4:456/456 of 8jdsA
- binding flavin-adenine dinucleotide: E32 (≠ A42), P68 (= P78), G70 (= G80), T71 (≠ A81), G72 (= G82), T73 (= T83), G74 (≠ S84), G78 (= G88), V79 (≠ A89), L90 (≠ M100), P132 (= P142), G133 (≠ S143), A134 (≠ S144), G140 (= G152), M141 (≠ N153), A143 (= A155), T144 (≠ E156), A146 (≠ S158), S147 (≠ G159), E200 (= E208), G201 (= G209), I206 (≠ V214), W323 (≠ F335), E414 (= E424), H415 (= H425), N451 (= N461)
- binding manganese (ii) ion: H370 (= H380), H377 (= H387), E414 (= E424)
- binding pyruvic acid: R319 (= R331), H370 (= H380), H377 (= H387), H415 (= H425)
8jdtA Crystal structure of mldhd in complex with 2-ketobutanoic acid (see paper)
30% identity, 92% coverage: 14:466/493 of query aligns to 4:455/455 of 8jdtA
- binding 2-ketobutyric acid: R318 (= R331), H369 (= H380), H376 (= H387), H414 (= H425)
- binding flavin-adenine dinucleotide: P68 (= P78), G70 (= G80), T71 (≠ A81), G72 (= G82), T73 (= T83), G74 (≠ S84), G78 (= G88), V79 (≠ A89), L90 (≠ M100), P132 (= P142), G133 (≠ S143), A134 (≠ S144), G140 (= G152), M141 (≠ N153), A143 (= A155), T144 (≠ E156), A146 (≠ S158), S147 (≠ G159), E200 (= E208), G201 (= G209), I206 (≠ V214), W322 (≠ F335), E413 (= E424), H414 (= H425), N450 (= N461)
- binding manganese (ii) ion: H369 (= H380), H376 (= H387), E413 (= E424)
8jduA Crystal structure of mldhd in complex with 2-ketovaleric acid (see paper)
31% identity, 92% coverage: 14:466/493 of query aligns to 4:455/455 of 8jduA
- binding 2-oxopentanoic acid: R318 (= R331), W322 (≠ F335), H369 (= H380), H376 (= H387), H414 (= H425)
- binding flavin-adenine dinucleotide: P68 (= P78), G70 (= G80), T71 (≠ A81), G72 (= G82), T73 (= T83), G74 (≠ S84), G78 (= G88), V79 (≠ A89), L90 (≠ M100), P132 (= P142), G133 (≠ S143), A134 (≠ S144), G140 (= G152), M141 (≠ N153), A143 (= A155), T144 (≠ E156), A146 (≠ S158), S147 (≠ G159), E200 (= E208), G201 (= G209), I206 (≠ V214), W322 (≠ F335), E413 (= E424), N450 (= N461)
- binding manganese (ii) ion: H369 (= H380), H376 (= H387), E413 (= E424)
8jdpA Crystal structure of h405a mldhd in complex with d-2-hydroxyisovaleric acid (see paper)
30% identity, 92% coverage: 14:466/493 of query aligns to 4:455/455 of 8jdpA
- binding flavin-adenine dinucleotide: P68 (= P78), G70 (= G80), T71 (≠ A81), G72 (= G82), T73 (= T83), G74 (≠ S84), G78 (= G88), V79 (≠ A89), L90 (≠ M100), P132 (= P142), G133 (≠ S143), A134 (≠ S144), G140 (= G152), M141 (≠ N153), A143 (= A155), T144 (≠ E156), A146 (≠ S158), S147 (≠ G159), E200 (= E208), G201 (= G209), I206 (≠ V214), H369 (= H380), E413 (= E424), N450 (= N461)
- binding deaminohydroxyvaline: R319 (= R331), H414 (= H425)
8jdxA Crystal structure of mldhd in complex with 2-ketoisovaleric acid (see paper)
30% identity, 92% coverage: 14:466/493 of query aligns to 4:455/455 of 8jdxA
- binding flavin-adenine dinucleotide: E32 (≠ A42), P68 (= P78), G70 (= G80), T71 (≠ A81), G72 (= G82), T73 (= T83), G74 (≠ S84), G78 (= G88), V79 (≠ A89), L90 (≠ M100), P132 (= P142), G133 (≠ S143), A134 (≠ S144), G140 (= G152), M141 (≠ N153), A143 (= A155), T144 (≠ E156), A146 (≠ S158), S147 (≠ G159), E200 (= E208), G201 (= G209), I206 (≠ V214), W322 (≠ F335), E413 (= E424), H414 (= H425), N450 (= N461)
- binding 3-methyl-2-oxobutanoic acid: R318 (= R331), H369 (= H380), H376 (= H387), H414 (= H425)
- binding manganese (ii) ion: H369 (= H380), H376 (= H387), E413 (= E424)
8jdrA Crystal structure of h405a mldhd in complex with d-2-hydroxy-3-methyl- valeric acid (see paper)
30% identity, 92% coverage: 14:466/493 of query aligns to 4:456/456 of 8jdrA
- binding flavin-adenine dinucleotide: P68 (= P78), G70 (= G80), T71 (≠ A81), G72 (= G82), T73 (= T83), G74 (≠ S84), G78 (= G88), V79 (≠ A89), L90 (≠ M100), P132 (= P142), G133 (≠ S143), A134 (≠ S144), G140 (= G152), M141 (≠ N153), A143 (= A155), T144 (≠ E156), A146 (≠ S158), S147 (≠ G159), E200 (= E208), G201 (= G209), I206 (≠ V214), Y324 (≠ P336), H370 (= H380), E414 (= E424), N451 (= N461)
- binding (2R,3S)-3-methyl-2-oxidanyl-pentanoic acid: R319 (= R331), W323 (≠ F335), H415 (= H425)
8jdqA Crystal structure of h405a mldhd in complex with d-2-hydroxyisocaproic acid (see paper)
30% identity, 92% coverage: 14:466/493 of query aligns to 4:456/456 of 8jdqA
- binding (2R)-2-hydroxy-4-methylpentanoic acid: R319 (= R331), W323 (≠ F335), H370 (= H380), H415 (= H425)
- binding flavin-adenine dinucleotide: P68 (= P78), G70 (= G80), T71 (≠ A81), G72 (= G82), T73 (= T83), G74 (≠ S84), G78 (= G88), V79 (≠ A89), L90 (≠ M100), P132 (= P142), G133 (≠ S143), A134 (≠ S144), G140 (= G152), M141 (≠ N153), A143 (= A155), T144 (≠ E156), A146 (≠ S158), S147 (≠ G159), E200 (= E208), G201 (= G209), I206 (≠ V214), H370 (= H380), E414 (= E424), N451 (= N461)
8jdoA Crystal structure of h405a mldhd in complex with d-2-hydroxyhexanoic acid (see paper)
30% identity, 92% coverage: 14:466/493 of query aligns to 4:456/456 of 8jdoA
- binding (2R)-2-hydroxyhexanoic acid: R319 (= R331), W323 (≠ F335), H415 (= H425)
- binding flavin-adenine dinucleotide: P68 (= P78), G70 (= G80), T71 (≠ A81), G72 (= G82), T73 (= T83), G74 (≠ S84), G78 (= G88), V79 (≠ A89), L90 (≠ M100), P132 (= P142), G133 (≠ S143), A134 (≠ S144), G140 (= G152), M141 (≠ N153), A143 (= A155), T144 (≠ E156), A146 (≠ S158), S147 (≠ G159), E200 (= E208), G201 (= G209), I206 (≠ V214), Y324 (≠ P336), H370 (= H380), E414 (= E424), N451 (= N461)
8jdnA Crystal structure of h405a mldhd in complex with d-2-hydroxyvaleric acid (see paper)
30% identity, 92% coverage: 14:466/493 of query aligns to 4:456/456 of 8jdnA
- binding flavin-adenine dinucleotide: P68 (= P78), G70 (= G80), T71 (≠ A81), G72 (= G82), T73 (= T83), G74 (≠ S84), G78 (= G88), V79 (≠ A89), L90 (≠ M100), P132 (= P142), G133 (≠ S143), A134 (≠ S144), G140 (= G152), M141 (≠ N153), A143 (= A155), T144 (≠ E156), A146 (≠ S158), S147 (≠ G159), E200 (= E208), G201 (= G209), I206 (≠ V214), H370 (= H380), E414 (= E424), N451 (= N461)
- binding (2R)-2-oxidanylpentanoic acid: R319 (= R331), W323 (≠ F335), H415 (= H425)
8jdgA Crystal structure of h405a mldhd in complex with d-2-hydroxybutanoic acid (see paper)
30% identity, 92% coverage: 14:466/493 of query aligns to 4:456/456 of 8jdgA
- binding flavin-adenine dinucleotide: P68 (= P78), G70 (= G80), T71 (≠ A81), G72 (= G82), T73 (= T83), G74 (≠ S84), G78 (= G88), V79 (≠ A89), L90 (≠ M100), P132 (= P142), G133 (≠ S143), A134 (≠ S144), G140 (= G152), M141 (≠ N153), A143 (= A155), T144 (≠ E156), A146 (≠ S158), S147 (≠ G159), E200 (= E208), G201 (= G209), I206 (≠ V214), H370 (= H380), E414 (= E424), N451 (= N461)
- binding (2R)-2-oxidanylbutanoic acid: R319 (= R331), H415 (= H425)
8jdbA Crystal structure of h405a mldhd in complex with d-2-hydroxyoctanoic acid (see paper)
30% identity, 92% coverage: 14:466/493 of query aligns to 4:456/456 of 8jdbA
- binding flavin-adenine dinucleotide: P68 (= P78), G70 (= G80), T71 (≠ A81), G72 (= G82), T73 (= T83), G74 (≠ S84), G78 (= G88), V79 (≠ A89), L90 (≠ M100), P132 (= P142), G133 (≠ S143), A134 (≠ S144), G140 (= G152), M141 (≠ N153), A143 (= A155), T144 (≠ E156), A146 (≠ S158), S147 (≠ G159), E200 (= E208), G201 (= G209), I206 (≠ V214), Y324 (≠ P336), H370 (= H380), E414 (= E424), N451 (= N461)
- binding (2R)-2-oxidanyloctanoic acid: V75 (≠ L85), R319 (= R331), W323 (≠ F335), H415 (= H425)
8jdzA Crystal structure of mldhd in complex with 2-keto-3-methylvaleric acid (see paper)
30% identity, 92% coverage: 14:466/493 of query aligns to 4:454/454 of 8jdzA
- binding (3S)-3-methyl-2-oxopentanoic acid: R318 (= R331), W322 (≠ F335), H369 (= H380), H376 (= H387), H413 (= H425)
- binding flavin-adenine dinucleotide: E32 (≠ A42), P68 (= P78), G70 (= G80), T71 (≠ A81), G72 (= G82), T73 (= T83), G74 (≠ S84), G78 (= G88), V79 (≠ A89), L90 (≠ M100), P132 (= P142), G133 (≠ S143), A134 (≠ S144), G140 (= G152), M141 (≠ N153), A143 (= A155), T144 (≠ E156), A146 (≠ S158), S147 (≠ G159), E200 (= E208), G201 (= G209), I206 (≠ V214), W322 (≠ F335), E412 (= E424), H413 (= H425), N449 (= N461)
- binding manganese (ii) ion: H369 (= H380), H376 (= H387), E412 (= E424)
8jdyA Crystal structure of mldhd in complex with 2-ketoisocaproic acid (see paper)
30% identity, 92% coverage: 14:466/493 of query aligns to 4:454/454 of 8jdyA
- binding 2-oxo-4-methylpentanoic acid: R318 (= R331), W322 (≠ F335), S336 (≠ C347), H369 (= H380), H376 (= H387), H413 (= H425)
- binding flavin-adenine dinucleotide: P68 (= P78), G70 (= G80), T71 (≠ A81), G72 (= G82), T73 (= T83), G74 (≠ S84), G78 (= G88), V79 (≠ A89), L90 (≠ M100), P132 (= P142), G133 (≠ S143), A134 (≠ S144), G140 (= G152), M141 (≠ N153), A143 (= A155), T144 (≠ E156), A146 (≠ S158), S147 (≠ G159), E200 (= E208), G201 (= G209), I206 (≠ V214), E412 (= E424), N449 (= N461)
- binding manganese (ii) ion: H369 (= H380), H376 (= H387), E412 (= E424)
6lpnB Crystal structure of human d-2-hydroxyglutarate dehydrogenase in apo form (see paper)
31% identity, 92% coverage: 16:468/493 of query aligns to 15:467/467 of 6lpnB
- binding flavin-adenine dinucleotide: W40 (≠ A42), P76 (= P78), G78 (= G80), G79 (≠ A81), N80 (≠ G82), T81 (= T83), G82 (≠ S84), M83 (≠ L85), G86 (= G88), S87 (≠ A89), L140 (≠ P142), A142 (≠ S144), C146 (= C148), H147 (≠ T149), G150 (= G152), N151 (= N153), A153 (= A155), T154 (≠ E156), G208 (= G209), I212 (≠ V213), I213 (≠ V214), E423 (= E424), N460 (= N461)
6lpxA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with 2-oxoglutarate (2-og) (see paper)
31% identity, 92% coverage: 16:468/493 of query aligns to 14:466/466 of 6lpxA
- binding 2-oxoglutaric acid: R333 (= R331), T337 (≠ F335), K348 (≠ C347), Y379 (≠ V378), H381 (= H380), H388 (= H387), H423 (= H425)
- binding flavin-adenine dinucleotide: W39 (≠ A42), P75 (= P78), Q76 (≠ R79), G77 (= G80), G78 (≠ A81), N79 (≠ G82), T80 (= T83), G81 (≠ S84), M82 (≠ L85), G85 (= G88), S86 (≠ A89), L139 (≠ P142), G140 (≠ S143), A141 (≠ S144), C145 (= C148), G149 (= G152), N150 (= N153), A152 (= A155), T153 (≠ E156), G157 (= G160), G207 (= G209), I212 (≠ V214), E422 (= E424), N459 (= N461)
- binding zinc ion: H381 (= H380), H388 (= H387), E422 (= E424)
6lpuA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with l-2-hydroxyglutarate (l-2-hg) (see paper)
31% identity, 92% coverage: 16:468/493 of query aligns to 14:466/466 of 6lpuA
- binding flavin-adenine dinucleotide: W39 (≠ A42), P75 (= P78), G77 (= G80), G78 (≠ A81), N79 (≠ G82), T80 (= T83), G81 (≠ S84), G85 (= G88), S86 (≠ A89), L139 (≠ P142), G140 (≠ S143), A141 (≠ S144), C145 (= C148), H146 (≠ T149), G148 (= G151), G149 (= G152), N150 (= N153), A152 (= A155), T153 (≠ E156), A155 (≠ S158), E206 (= E208), G207 (= G209), I211 (≠ V213), I212 (≠ V214), E422 (= E424), N459 (= N461)
- binding (2s)-2-hydroxypentanedioic acid: R333 (= R331), T337 (≠ F335), K348 (≠ C347), Y379 (≠ V378), H381 (= H380), H388 (= H387), H423 (= H425)
- binding zinc ion: H381 (= H380), H388 (= H387), E422 (= E424)
Query Sequence
>Ga0059261_2631 FitnessBrowser__Korea:Ga0059261_2631
MPPPDPATLARRAEIVAAMRAIVPGEGVIDALEALRPYESDALTAYAQVPLLVVLPETVE
QVAAVLRWCHENRVKVVPRGAGTSLSGGALPLADGVLLGMARFNRVLDIDYADRVAVVQP
GVTNLAITRAVEDAGFYYAPDPSSQIACTIGGNVAENSGGVHCLKYGLTTNNVLGVELVT
IEGEVVRLGGRGLEPAGLDLLGVIVGSEGLLGVVTEVTVRILPRPETAKALLIGFPDVES
AGVCVAQIIAAGIIPAGMEMMDKPAINAAEAFVNAGYPLDVEALLIVELDGPGAECGHLT
GEVEAIARAHGAVSVQASRDDAERALFWAGRKAAFPAAGRISPDYYCMDGTIPRRRLPEV
LTRMKALSEQYGLGVINVFHAGDGNLHPLILYDANQPGQLERAEAFGADILKLCVEVGGV
LTGEHGVGVEKRDLMHTMFSETDLAQQQRVKCAFDPELLLNPGKMFPELHRCAELGRMHV
HRGQVPFPELPRF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory